Ribosomal Protein L24 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-85636

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-85636-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all Ribosomal Protein L24 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human Ribosomal Protein L24. Peptide sequence: FLNAKCESAFLSKRNPRQINWTVLYRRKHKKGQSEEIQKKRTRRAVKFQR The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Ribosomal Protein L24 Antibody

Western Blot: Ribosomal Protein L24 Antibody [NBP2-85636]

Western Blot: Ribosomal Protein L24 Antibody [NBP2-85636]

Western Blot: Ribosomal Protein L24 Antibody [NBP2-85636] - Host: Rabbit. Target Name: RPL24. Sample Type: Jurkat Whole Cell lysates. Antibody Dilution: 1.0ug/ml
Western Blot: Ribosomal Protein L24 Antibody [NBP2-85636]

Western Blot: Ribosomal Protein L24 Antibody [NBP2-85636]

Western Blot: Ribosomal Protein L24 Antibody [NBP2-85636] - Host: Rabbit. Target Name: RPL24. Sample Tissue: Human HCT116 Whole Cell. Antibody Dilution: 1ug/ml

Applications for Ribosomal Protein L24 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Ribosomal Protein L24

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L24E family of ribosomal proteins. It is located in the cytoplasm. This gene has been referred to as ribosomal protein L30 because the encoded protein shares amino acid identity with the L30 ribosomal proteins from S. cerevisiae; however, its official name is ribosomal protein L24. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq, Jul 2008]

Alternate Names

60S ribosomal protein L24, 60S ribosomal protein L30, L24, ribosomal protein L30, RPL24

Gene Symbol

RPL24

Additional Ribosomal Protein L24 Products

Product Documents for Ribosomal Protein L24 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Ribosomal Protein L24 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.