RPSA Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-59114

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-59114
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all RPSA Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to RPSA(ribosomal protein SA) The peptide sequence was selected from the middle region of RPSA (NP_002286). Peptide sequence TFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNLPTIALCNTDSPLRY. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for RPSA Antibody

Western Blot: RPSA Antibody [NBP1-59114]

Western Blot: RPSA Antibody [NBP1-59114]

Western Blot: RPSA Antibody [NBP1-59114] - Human Fetal Thymus tissue lysate at a concentration of 1ug/ml.
Immunohistochemistry-Paraffin: RPSA Antibody [NBP1-59114]

Immunohistochemistry-Paraffin: RPSA Antibody [NBP1-59114]

Immunohistochemistry-Paraffin: RPSA Antibody [NBP1-59114] - Human spleen tissue at an antibody concentration of 5ug/ml.
Western Blot: RPSA Antibody [NBP1-59114]

Western Blot: RPSA Antibody [NBP1-59114]

Western Blot: RPSA Antibody [NBP1-59114] - Antibody Titration: 1 ug/ml Positive control: Human Kidney.

Applications for RPSA Antibody

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

5 ug/ml

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RPSA

RPSA is required for the assembly and/or stability of the 40S ribosomal subunit. RPSA is also required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits. Also functions as a cell surface receptor for laminin. RPSA plays a role in cell adhesion to the basement membrane and in the consequent activation of signaling transduction pathways. RPSA may play a role in cell fate determination and tissue morphogenesis. RPSA also acts as a receptor for several other ligands, including the pathogenic prion protein, viruses, and bacteria.Laminins, a family of extracellular matrix glycoproteins, are the major noncollagenous constituent of basement membranes. They have been implicated in a wide variety of biological processes including cell adhesion, differentiation, migration, signaling, neurite outgrowth and metastasis. Many of the effects of laminin are mediated through interactions with cell surface receptors. These receptors include members of the integrin family, as well as non-integrin laminin-binding proteins. This gene encodes a high-affinity, non-integrin family, laminin receptor 1. This receptor has been variously called 67 kD laminin receptor, 37 kD laminin receptor precursor (37LRP) and p40 ribosome-associated protein. The amino acid sequence of laminin receptor 1 is highly conserved through evolution, suggesting a key biological function. It has been observed that the level of the laminin receptor transcript is higher in colon carcinoma tissue and lung cancer cell line than their normal counterparts. Also, there is a correlation between the upregulation of this polypeptide in cancer cells and their invasive and metastatic phenotype. Multiple copies of this gene exist, however, most of them are pseudogenes thought to have arisen from retropositional events. Two alternatively spliced transcript variants encoding the same protein have been found for this gene.

Alternate Names

37 kDa laminin receptor precursor, 37/67 kDa laminin receptor, 37LRPNEM/1CHD4, 67 kDa laminin receptor, 67kD, ribosomal protein SA, 67LR, Colon carcinoma laminin-binding protein, LAMBR37 kDa laminin receptor, laminin binding protein, Laminin receptor 1, laminin receptor 1 (67kD, ribosomal protein SA), Laminin-binding protein precursor p40, lamR, LAMR 1, LAMR140S ribosomal protein SA, LBP, LBP/p40, LRP, LRP/LR, Multidrug resistance-associated protein MGr1-Ag, p40, ribosomal protein SA

Entrez Gene IDs

3921 (Human)

Gene Symbol

RPSA

UniProt

P08865 (Human)

Additional RPSA Products

Product Documents for RPSA Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for RPSA Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.