RUVBL1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-84914

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-84914
NBP1-84914-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown, Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all RUVBL1 Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: GKTISHVIIGLKTAKGTKQLKLDPSIFESLQKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDV

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23443080).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RUVBL1 Antibody

Western Blot: RUVBL1 Antibody [NBP1-84914]

Western Blot: RUVBL1 Antibody [NBP1-84914]

Western Blot: RUVBL1 Antibody [NBP1-84914] - Analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-RUVBL1 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Immunocytochemistry/ Immunofluorescence: RUVBL1 Antibody [NBP1-84914]

Immunocytochemistry/ Immunofluorescence: RUVBL1 Antibody [NBP1-84914]

Immunocytochemistry/Immunofluorescence: RUVBL1 Antibody [NBP1-84914] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RUVBL1 Antibody [NBP1-84914]

Immunohistochemistry-Paraffin: RUVBL1 Antibody [NBP1-84914]

Immunohistochemistry-Paraffin: RUVBL1 Antibody [NBP1-84914] - Staining of human fallopian tube using Anti-RUVBL1 antibody NBP1-84914.
View 7 more images

Applications for RUVBL1 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RUVBL1

Possesses single-stranded DNA-stimulated ATPase and ATP-dependent DNA helicase (3' to 5') activity. Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. The NuA4 complex ATPase and helicase activities seem to be, at least in part, contributed by the association of RUVBL1 and RUVBL2 with EP400. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage. RUVBL1 plays an essential role in oncogenic transformation by MYC and also modulates transcriptional activation by the LEF1/TCF1-CTNNB1 complex

Alternate Names

49 kDa TATA box-binding protein-interacting protein, 54 kDa erythrocyte cytosolic protein, EC 3.6.1, EC 3.6.4.12,49 kDa TBP-interacting protein, ECP54, INO80 complex subunit H, INO80HTIP49A, NMP 238, NMP238ECP-54, Nuclear matrix protein 238, PONTIN, Pontin 52, Pontin52, RuvB (E coli homolog)-like 1, ruvB-like 1, RuvB-like 1 (E. coli), Rvb1, TATA binding protein interacting protein 49 kDa, TIH1, TIP49a, TIP49TAP54-alpha, TIP60-associated protein 54-alpha

Gene Symbol

RUVBL1

Additional RUVBL1 Products

Product Documents for RUVBL1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for RUVBL1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.