S100A11 Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-03232

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-03232-100ul
NBP3-03232-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, Knockout Validated, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all S100A11 Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human S100A11 (NP_005611.1). MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

11 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for S100A11 Antibody - BSA Free

Western Blot: S100A11 AntibodyBSA Free [NBP3-03232]

Western Blot: S100A11 AntibodyBSA Free [NBP3-03232]

Western Blot: S100A11 Antibody [NBP3-03232] - Analysis of extracts of various cell lines, using S100A11 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit.
Immunocytochemistry/ Immunofluorescence: S100A11 Antibody - BSA Free [NBP3-03232]

Immunocytochemistry/ Immunofluorescence: S100A11 Antibody - BSA Free [NBP3-03232]

Immunocytochemistry/Immunofluorescence: S100A11 Antibody [NBP3-03232] - Analysis of U2OS cells using S100A11 antibody . Blue: DAPI for nuclear staining.
Knockout Validated: S100A11 Antibody - BSA Free [NBP3-03232]

Knockout Validated: S100A11 Antibody - BSA Free [NBP3-03232]

Knockout Validated: S100A11 Antibody [NBP3-03232] - Analysis of extracts from normal (control) and S100A11 knockout (KO) HeLa cells, using S100A11 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.
View 1 more images

Applications for S100A11 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunoprecipitation

1:500 - 1:1000

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS with 50% glycerol, pH7.3.

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: S100A11

S100A11 is encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis.

Long Name

S100 Calcium Binding Protein A11

Alternate Names

Calgizzarin, MLN70, S100C

Gene Symbol

S100A11

Additional S100A11 Products

Product Documents for S100A11 Antibody - BSA Free

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for S100A11 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.