S1P1/EDG-1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-58024

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-58024
NBP2-58024-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all S1P1/EDG-1 Antibodies »

Product Summary for S1P1/EDG-1 Antibody

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYT

Reactivity Notes

Mouse 81%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for S1P1/EDG-1 Antibody

Immunocytochemistry/ Immunofluorescence: S1P1/EDG-1 Antibody [NBP2-58024]

Immunocytochemistry/ Immunofluorescence: S1P1/EDG-1 Antibody [NBP2-58024]

Immunocytochemistry/Immunofluorescence: S1P1/EDG-1 Antibody [NBP2-58024] - Staining of human cell line U-251 MG shows localization to vesicles. Antibody staining is shown in green.

Applications for S1P1/EDG-1 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: S1P1/EDG-1

EBP 50 [ERM (ezrin-radixin-moesin) binding phosphoprotein of 50 kDa] is a PDZ containing protein that is involved in the linkage of integral membrane proteins to the cytoskeleton. EBP50 contains two tandem PDZ domains followed by a carboxy-terminal sequence that binds to members of the ERM family of membrane-cytoskeleton adaptors. The PDZ domains within EBP50 bind to the carboxy termini of such target proteins as beta2 adrenergic receptor, platelet-derived growth factor receptor (PDGFR), and the cystic fibrosis conductance regulator (CFTR). The PDZ domains are also believed to be involved in the oligomerization of EBP 50 to form multiprotein complexes which helps to facilitate the formation of functional signalling complexes. EBP 50 has been shown to link integral membrane proteins to the cytoskeleton by binding to members of the ERM family of proteins, which bind to F-actin. Through these interactions, EBP 50 is implicated in the localization of interactive groups of proteins into subcellular domains and in the regulation of activity of those interacting proteins. Immunohistochemical studies have shown that EBP 50 is found exclusively at the apical membranes of epithelial cells.

Long Name

Endothelial Differentiation Gene 1

Alternate Names

CD363, EDG1, S1PR1

Gene Symbol

S1PR1

Additional S1P1/EDG-1 Products

Product Documents for S1P1/EDG-1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for S1P1/EDG-1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.