SEC23A Antibody (1D4R7)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16667

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-16667-100ul
NBP3-16667-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 1D4R7

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all SEC23A Antibodies »

Product Summary for SEC23A Antibody (1D4R7)

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 300-400 of human Sec23AA (Q15436). MVVGDELKTPIRSWHDIDKDNAKYVKKGTKHFEALANRAATTGHVIDIYACALDQTGLLEMKCCPNLTGGYMVMGDSFNTSLFKQTFQRVFTKDMHGQFKM

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SEC23A Antibody (1D4R7)

Western Blot: SEC23A Antibody (1D4R7) [NBP3-16667]

Western Blot: SEC23A Antibody (1D4R7) [NBP3-16667]

Western Blot: SEC23A Antibody (1D4R7) [NBP3-16667] - Western blot analysis of extracts of HepG2 cells, using SEC23AA Rabbit mAb (NBP3-16667) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunocytochemistry/ Immunofluorescence: SEC23A Antibody (1D4R7) [NBP3-16667]

Immunocytochemistry/ Immunofluorescence: SEC23A Antibody (1D4R7) [NBP3-16667]

Immunocytochemistry/Immunofluorescence: SEC23A Antibody (1D4R7) [NBP3-16667] - Immunofluorescence analysis of NIH-3T3 cells using SEC23AA Rabbit mAb (NBP3-16667) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: SEC23A Antibody (1D4R7) [NBP3-16667]

Immunohistochemistry-Paraffin: SEC23A Antibody (1D4R7) [NBP3-16667]

Immunohistochemistry-Paraffin: SEC23A Antibody (1D4R7) [NBP3-16667] - Immunohistochemistry of paraffin-embedded mouse kidney using SEC23AA Rabbit mAb (NBP3-16667) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
View 2 more images

Applications for SEC23A Antibody (1D4R7)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SEC23A

SEC23A is encoded by this gene is a member of the SEC23 subfamily of the SEC23/SEC24 family. It is part of a protein complex and found in the ribosome-free transitional face of the endoplasmic reticulum (ER) and associated vesicles. This protein has similarity to yeast Sec23p component of COPII. COPII is the coat protein complex responsible for vesicle budding from the ER. The encoded protein is suggested to play a role in the ER-Golgi protein trafficking. [provided by RefSeq]

Alternate Names

CLSD, MGC26267, protein transport protein Sec23A, Sec23 (S. cerevisiae) homolog A, Sec23 homolog A (S. cerevisiae), SEC23-related protein A

Gene Symbol

SEC23A

Additional SEC23A Products

Product Documents for SEC23A Antibody (1D4R7)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for SEC23A Antibody (1D4R7)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.