SERCA2 ATPase Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-59203

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-59203
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Monkey

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all SERCA2 ATPase Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to ATP2A2(ATPase, Ca++ transporting, cardiac muscle, slow twitch 2) The peptide sequence was selected from the C terminal of ATP2A2. Peptide sequence VNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIGCYV. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

115 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SERCA2 ATPase Antibody

Western Blot: SERCA2 ATPase Antibody [NBP1-59203]

Western Blot: SERCA2 ATPase Antibody [NBP1-59203]

Western Blot: SERCA2 ATPase Antibody [NBP1-59203] - (G) Immunoblots of control (C) and proband (P1, P2, P3) cell lysates demonstrate equivalent levels of SERCA2b and IP3R1 Ca2+ channels using rabbit anti-SERCA2 (Novus Biologicals; NBP1-59203) and rabbit anti-IP3R1 (Novus Biologicals; NB120-5908). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/27441836) licensed under a CC-BY license.
Immunohistochemistry: SERCA2 ATPase Antibody [NBP1-59203]

Immunohistochemistry: SERCA2 ATPase Antibody [NBP1-59203]

Immunohistochemistry: SERCA2 ATPase Antibody [NBP1-59203] - Rhesus macaque spinal cord Primary Antibody Dilution: 1 : 300 Secondary Antibody: Donkey anti Rabbit 488 Secondary Antibody Dilution: 1 : 500Color/Signal Descriptions: Green: ATP2A2 Gene name: APLP2 Submitted by: Timur Mavlyutov, Ph. D. , Department of Pharmacology, University of Wisconsin Medical School, 1300 University Avenue, Madison, WI 53706.
Western Blot: SERCA2 ATPase Antibody [NBP1-59203]

Western Blot: SERCA2 ATPase Antibody [NBP1-59203]

Western Blot: SERCA2 ATPase Antibody [NBP1-59203] - Human MCF-7. Titration: 0.2-1 ug/ml, Positive Control: MCF7 cell lysate.

Applications for SERCA2 ATPase Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SERCA2 ATPase

ATP2A2 is one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol into the sarcoplasmic reticulum lumen, and is involved in regulation of the contraction/relaxation cycle. Mutations in this gene cause Darier-White disease, also known as keratosis follicularis, an autosomal dominant skin disorder characterized by loss of adhesion between epidermal cells and abnormal keratinization. Alternative splicing results in multiple transcript variants encoding different isoforms.This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in regulation of the contraction/relaxation cycle. Mutations in this gene cause Darier-White disease, also known as keratosis follicularis, an autosomal dominant skin disorder characterized by loss of adhesion between epidermal cells and abnormal keratinization. Alternative splicing results in two transcript variants encoding different isoforms.

Long Name

Sarcoplasmic/endoplasmic reticulum calcium ATPase 2

Alternate Names

ATP2A2, ATP2B, Calcium pump 2, SERCA2, SR Ca(2+)-ATPase 2

Gene Symbol

ATP2A2

UniProt

P16615 (Human)

Additional SERCA2 ATPase Products

Product Documents for SERCA2 ATPase Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for SERCA2 ATPase Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.