SLC26A3 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-85745

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-85745-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all SLC26A3 Antibodies »

Product Summary for SLC26A3 Antibody

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SLC26A3. Peptide sequence: DAVLHILMKKDYSTSKFNPSQEKDGKIDFTINTNGGLRNRVYEVPVETKF The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for SLC26A3 Antibody

Western Blot: SLC26A3 Antibody [NBP2-85745]

Western Blot: SLC26A3 Antibody [NBP2-85745]

Western Blot: SLC26A3 Antibody [NBP2-85745] - Host: Rabbit. Target Name: SLC26A3. Sample Type: HepG2. Antibody Dilution: 1.0ug/mlSLC26A3 is supported by BioGPS gene expression data to be expressed in HepG2
Immunohistochemistry-Paraffin: SLC26A3 Antibody [NBP2-85745]

Immunohistochemistry-Paraffin: SLC26A3 Antibody [NBP2-85745]

Immunohistochemistry-Paraffin: SLC26A3 Antibody [NBP2-85745] - Rabbit Anti-SLC26A3 Antibody. Formalin Fixed Paraffin Embedded Tissue: Human Adult heart. Observed Staining: Membrane. Primary Antibody Concentration: 1:100. Secondary Antibody: Donkey anti-Rabbit-Cy2/3. Secondary Antibody Concentration: 1:200. Magnification: 20X.
Western Blot: SLC26A3 Antibody [NBP2-85745]

Western Blot: SLC26A3 Antibody [NBP2-85745]

Western Blot: SLC26A3 Antibody [NBP2-85745] - WB Suggested Anti-SLC26A3 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human Placenta
View 2 more images

Applications for SLC26A3 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC26A3

SLC26A3 is encoded by this gene is a transmembrane glycoprotein that functions as a sulfate transporter. It is localized to the mucosa of the lower intestinal tract, particularly to the apical membrane of columnar epithelium and some goblet cells. Mutations in this gene have been associated with congenital chloride diarrhea.

Alternate Names

chloride anion exchanger, CLD, congenital chloride diarrhea, down-regulated in adenoma protein, DRADown-regulated in adenoma, Protein DRA, Solute carrier family 26 member 3, solute carrier family 26, member 3

Gene Symbol

SLC26A3

Additional SLC26A3 Products

Product Documents for SLC26A3 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for SLC26A3 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.