SLC6A2/NET/Noradrenaline transporter Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-85762

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-85762-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all SLC6A2/NET Antibodies »

Product Summary for SLC6A2/NET/Noradrenaline transporter Antibody

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SLC6A2/NET/Noradrenaline transporter. Peptide sequence: FTPAAEFYERGVLHLHESSGIHDIGLPQWQLLLCLMVVVIVLYFSLWKGV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for SLC6A2/NET/Noradrenaline transporter Antibody

Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP2-85762]

Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP2-85762]

Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP2-85762] - Researcher: Lesie Sheiton, Physiological Sciences GIDP, University of Arizona. Application: Western blotting. Species + Tissue/Cell type: 1: 50ug human placenta lysate, 2: 50ug human placenta lysate, 3: 50ug sheep placenta lysate, 4: 50ug sheep placenta lysate. Primary antibody dilution: 1:1000. Secondary antibody: Anti-rabbit HRP. Secondary antibody dilution: 1:20,000
Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP2-85762]

Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP2-85762]

Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP2-85762] - WB Suggested Anti-SLC6A2 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: HepG2 cell lysate
Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP2-85762]

Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP2-85762]

Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP2-85762] - Host: Rabbit. Target Name: SLC6A2. Sample Tissue: Rat Brain. Antibody Dilution: 1ug/ml
View 1 more images

Applications for SLC6A2/NET/Noradrenaline transporter Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC6A2/NET

Norepinephrine Transporter [NET] (or noradrenaline transporter (NAT)) is a monoamine transporter that transports the neurotransmitter noradrenaline from the synapse back to its vesicles for storage until later use. It also appears to transport the neurotransmitter dopamine in the same way, but to a lesser degree. Studies have shown a decrease in NET levels in the locus coeruleus in patients diagnosed with major depression (Klimek et al., 1997). Cocaine, amphetamines and many therapeutic antidepressants, such as the SNRIs (Serotonin-norepinephrine reuptake inhibitors) and the tricyclic antidepressants (TCAs) act to raise noradrenaline. Furthermore, deficits in the NET gene have been associated with ADHD (Kim et al., 2006).

Long Name

Norepinephrine Transporter

Alternate Names

NAT1, Noradrenalin Transporter, Norepinephrine Transporter

Gene Symbol

SLC6A2

Additional SLC6A2/NET Products

Product Documents for SLC6A2/NET/Noradrenaline transporter Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for SLC6A2/NET/Noradrenaline transporter Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.