SLC9A7 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-62455

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-62455
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all SLC9A7 Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to SLC9A7(solute carrier family 9 (sodium/hydrogen exchanger), member 7) The peptide sequence was selected from the N terminal of SLC9A7. Peptide sequence LGWGLRVAAAASASSSGAAAEDSSAMEELATEKEAEESHRQDSVSLLTFI. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

80 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SLC9A7 Antibody

Western Blot: SLC9A7 Antibody [NBP1-62455]

Western Blot: SLC9A7 Antibody [NBP1-62455]

Western Blot: SLC9A7 Antibody [NBP1-62455] - Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.

Applications for SLC9A7 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC9A7

Organelles of the secretory and endocytic pathways are distinguished by their luminal acidity, which is generated by the activity of an electrogenic vacuolar-type hydrogen ATPase. Progressive acidification of vesicles in the endocytic pathway is essential for the redistribution and degradation of internalized membrane proteins, such as ligand receptor complexes and fluid-phase solutes. It may play an important role in maintaining cation homeostasis and function of the trans-Golgi network.Organelles of the secretory and endocytic pathways are distinguished by their luminal acidity, which is generated by the activity of an electrogenic vacuolar-type hydrogen ATPase. Progressive acidification of vesicles in the endocytic pathway is essential for the redistribution and degradation of internalized membrane proteins, such as ligand receptor complexes and fluid-phase solutes. This gene is expressed predominantly in the trans-Golgi network, and mediates the influx of sodium or potassium in exchange for hydrogen. It may thus play an important role in maintaining cation homeostasis and function of the trans-Golgi network. This gene is part of a gene cluster on chromosome Xp11.23.Organelles of the secretory and endocytic pathways are distinguished by their luminal acidity, which is generated by the activity of an electrogenic vacuolar-type hydrogen ATPase. Progressive acidification of vesicles in the endocytic pathway is essential for the redistribution and degradation of internalized membrane proteins, such as ligand receptor complexes and fluid-phase solutes. This gene is expressed predominantly in the trans-Golgi network, and mediates the influx of sodium or potassium in exchange for hydrogen. It may thus play an important role in maintaining cation homeostasis and function of the trans-Golgi network. This gene is part of a gene cluster on chromosome Xp11.23.

Long Name

Sodium/hydrogen exchanger 7

Alternate Names

NHE-7, NHE7

Gene Symbol

SLC9A7

Additional SLC9A7 Products

Product Documents for SLC9A7 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for SLC9A7 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.