SLP-2 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-79903

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-79903
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all SLP-2 Antibodies »

Product Specifications

Immunogen

The specific Immunogen is proprietary information. Peptide sequence VTSMVAQAMGVYGALTKAPVPGTPDSLSSGSSRDVQGTDASLDEELDRVK. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SLP-2 Antibody

Western Blot: SLP-2 Antibody [NBP1-79903]

Western Blot: SLP-2 Antibody [NBP1-79903]

Western Blot: SLP-2 Antibody [NBP1-79903] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Western Blot: SLP-2 Antibody [NBP1-79903]

Western Blot: SLP-2 Antibody [NBP1-79903]

Western Blot: SLP-2 Antibody [NBP1-79903] - Titration: 1.0 ug/ml Positive Control: 721_B Whole Cell.
Western Blot: SLP-2 Antibody [NBP1-79903]

Western Blot: SLP-2 Antibody [NBP1-79903]

Western Blot: SLP-2 Antibody [NBP1-79903] - Human 293T, Antibody Dilution: 1.0 ug/ml STOML2 is supported by BioGPS gene expression data to be expressed in HEK293T.

Applications for SLP-2 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLP-2

STOML2 is similar in sequence to stomatin. It is a 356 amino acid protein with a calculated molecular mass of 38.5 kDa. STOML2 has 3 potential initiator sites, all sharing the same open reading frame. The STOML2 protein contains the cognate stomatin family consensus sequence, but it lacks the characteristic N-terminal hydrophobic domain and palmitoylation consensus sequence. STOML2 shares greatest sequence homology with stomatin and SLP1 in a region predicted to contain beta sheet and alpha helix structures. Northern blot analysis detected a 1.5 kb STOML2 transcript in all tissues examined, with highest levels in heart, liver, and pancreas. Western blot analysis detected STOML2 at apparent molecular masses of 45.5 kDa or 44.6 kDa in all human and mammalian cell lines and tissues examined, including red blood cells. Some cells also showed a faint band at about 34.3 kDa, which may represent translation from an alternate initiation site.

Alternate Names

EPB72-like protein 2, HSPC108, SLP2, SLP-2stomatin-like protein 2, stomatin (EPB72)-like 2, stomatin-like 2

Gene Symbol

STOML2

UniProt

NP_038470 (Human)

Additional SLP-2 Products

Product Documents for SLP-2 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for SLP-2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.