SMARCD2 Antibody (2B2)

Novus Biologicals, part of Bio-Techne | Catalog # H00006603-M02

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
H00006603-M02
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

ELISA, Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 2B2

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all SMARCD2 Antibodies »

Product Specifications

Immunogen

SMARCD2 (NP_003068, 398 a.a. ~ 474 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RDFMLSFSTDPQDFIQEWLRSQRRDLKIITDVIGNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGIRL

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Specificity

SMARCD2 - SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2 (2B2)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for SMARCD2 Antibody (2B2)

Western Blot: SMARCD2 Antibody (2B2) [H00006603-M02]

Western Blot: SMARCD2 Antibody (2B2) [H00006603-M02]

Western Blot: SMARCD2 Antibody (2B2) [H00006603-M02] - SMARCD2 monoclonal antibody (M02), clone 2B2. Analysis of SMARCD2 expression in NIH/3T3.
Immunocytochemistry/ Immunofluorescence: SMARCD2 Antibody (2B2) [H00006603-M02]

Immunocytochemistry/ Immunofluorescence: SMARCD2 Antibody (2B2) [H00006603-M02]

Immunocytochemistry/Immunofluorescence: SMARCD2 Antibody (2B2) [H00006603-M02] - Analysis of monoclonal antibody to SMARCD2 on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: SMARCD2 Antibody (2B2) [H00006603-M02]

Western Blot: SMARCD2 Antibody (2B2) [H00006603-M02]

Western Blot: SMARCD2 Antibody (2B2) [H00006603-M02] - SMARCD2 expression in Raw 264.7(Cat # L024V1 ).
View 2 more images

Applications for SMARCD2 Antibody (2B2)

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Antibody reactivity against cell lysate for WB. It has been used for IF and ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: SMARCD2

The protein encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Alternate Names

60 kDa BRG-1/Brm-associated factor subunit B, BAF60B, BRG1-associated factor 60B, chromatin remodeling complex BAF60B subunit, CRACD2, mammalian chromatin remodeling complex BRG1-associated factor 60B, PRO2451, Rsc6p, SWI/SNF complex 60 kDa subunit B, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2, SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2, Swp73-like protein

Entrez Gene IDs

6603 (Human)

Gene Symbol

SMARCD2

Additional SMARCD2 Products

Product Documents for SMARCD2 Antibody (2B2)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for SMARCD2 Antibody (2B2)

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.