SMN Antibody (9N9Q6)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16863

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-16863-100ul
NBP3-16863-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 9N9Q6

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all SMN Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 103-200 of human SMN (Q16637). SEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPPM

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SMN Antibody (9N9Q6)

Western Blot: SMN Antibody (9N9Q6) [NBP3-16863]

Western Blot: SMN Antibody (9N9Q6) [NBP3-16863]

Western Blot: SMN Antibody (9N9Q6) [NBP3-16863] - Western blot analysis of extracts of various cell lines, using SMN antibody (NBP3-16863) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunohistochemistry-Paraffin: SMN Antibody (9N9Q6) [NBP3-16863]

Immunohistochemistry-Paraffin: SMN Antibody (9N9Q6) [NBP3-16863]

Immunohistochemistry-Paraffin: SMN Antibody (9N9Q6) [NBP3-16863] - Immunohistochemistry of paraffin-embedded human lung cancer using SMN Rabbit mAb (NBP3-16863) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: SMN Antibody (9N9Q6) [NBP3-16863]

Immunohistochemistry-Paraffin: SMN Antibody (9N9Q6) [NBP3-16863]

Immunohistochemistry-Paraffin: SMN Antibody (9N9Q6) [NBP3-16863] - Immunohistochemistry of paraffin-embedded rat brain using SMN Rabbit mAb (NBP3-16863) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Applications for SMN Antibody (9N9Q6)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SMN

SMN (Gemin 1) is the central component of a large oligomeric complex (SMN complex), including Gemins 2-7, that is necessary and sufficient for the in vivo assembly of Sm proteins onto the small nuclear (sn)RNAs that mediate pre-mRNA splicing. The SMN complex is found in the cytoplasm and nucleus. Within the nucleus, this protein localizes to subnuclear bodies called gems which are found near coiled bodies containing high concentrations of small ribonucleoproteins (snRNPs). Spinal muscular atrophy, a motor neuron disorder, results from reduced levels or a mutation in the Gemin 1 protein.

Alternate Names

Gemin-1, Kugelberg-Welander disease), SMNC, survival motor neuron protein, survival of motor neuron 1, telomeric

Gene Symbol

SMN1

Additional SMN Products

Product Documents for SMN Antibody (9N9Q6)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for SMN Antibody (9N9Q6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.