Sodium Potassium ATPase Alpha 2 Antibody (5T3O4)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-15737

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-15737-100ul
NBP3-15737-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 5T3O4

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Sodium Potassium ATPase Alpha 2 Antibodies »

Product Summary for Sodium Potassium ATPase Alpha 2 Antibody (5T3O4)

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Sodium Potassium ATPase Alpha 2 (P50993). MGRGAGREYSPAATTAENGGGKKKQKEKELDELKKEVAMDDHKLSLDELGRKYQVDLSKGLTNQRAQDVLARDGPNALTPPPTTPEWVKFCRQLFGGFSI

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Sodium Potassium ATPase Alpha 2 Antibody (5T3O4)

Western Blot: Sodium Potassium ATPase Alpha 2 Antibody (5T3O4) [NBP3-15737]

Western Blot: Sodium Potassium ATPase Alpha 2 Antibody (5T3O4) [NBP3-15737]

Western Blot: Sodium Potassium ATPase Alpha 2 Antibody (5T3O4) [NBP3-15737] - Western blot analysis of extracts of various cell lines, using Sodium Potassium ATPase Alpha 2 antibody (NBP3-15737) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.

Applications for Sodium Potassium ATPase Alpha 2 Antibody (5T3O4)

Application
Recommended Usage

Western Blot

1:500 - 1:1000
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Sodium Potassium ATPase Alpha 2

The ubiquitously expressed sodium/potassium-ATPase exists as a oligomeric plasma membrane complex that couples the hydrolysis of one molecule of ATP to the importation of three Na+ ions and two K+ ions against their respective electrochemical gradients. As a member of the P-type family of ion motifs, sodium/potassium-ATPase plays a critical role in maintaining cellular volume, resting membrane potential and Na+-coupled solute transport. Multiple isoforms of three subunits, alpha, beta and gamma, comprise to form the sodium/potassium-ATPase oligomer. The 113 kDa alpha subunit contains the binding sites for ATP and the cations. With a molecular weight between 40 and 60 kDa, the glycosylated beta subunit ensures correct folding and membrane insertion of the alpha subunits. The small 6 kDa gamma subunit co-localizes with the alpha subunit in nephron segments, where it increases the affinity of sodium/potassium-ATPase for ATP. The beta subunit, but not the gamma subunit, is essential for normal activity of sodium/potassium-ATPase.

Long Name

Sodium/potassium-transporting ATPase subunit alpha-2

Alternate Names

ATP1A2, KIAA0778

Gene Symbol

ATP1A2

Additional Sodium Potassium ATPase Alpha 2 Products

Product Documents for Sodium Potassium ATPase Alpha 2 Antibody (5T3O4)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Sodium Potassium ATPase Alpha 2 Antibody (5T3O4)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.