SP-B/Surfactant Protein B Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-57977

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-57977
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Mouse, Rat

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all SP-B/Surfactant Protein B Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to SFTPB(surfactant, pulmonary-associated protein B) The peptide sequence was selected from the middle region of SFTPB. Peptide sequence PGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALAVAV. The peptide sequence for this immunogen was taken from within the described region.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 26092997). Use in Rat reported in scientific literature (PMID:31059017).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SP-B/Surfactant Protein B Antibody

Western Blot: SP-B/Surfactant Protein B Antibody [NBP1-57977]

Western Blot: SP-B/Surfactant Protein B Antibody [NBP1-57977]

Western Blot: SP-B/Surfactant Protein B Antibody [NBP1-57977] - Lung function in newborn and adult TNC KO and WT mice during HTV ventilation. Representative results of SP-B/Surfactant Protein B and SP-C protein detection in whole lung lysates from adult TNC KO and WT animals by Western blot; cropped blots are displayed. Full length blots are presented in Supplementary Figure S2. Image collected and cropped by CiteAb from the following publication (www.nature.com/articles/s41598-020-61919-x) licensed under a CC-BY license.
Immunohistochemistry: SP-B/Surfactant Protein B Antibody [NBP1-57977]

Immunohistochemistry: SP-B/Surfactant Protein B Antibody [NBP1-57977]

Immunohistochemistry: SP-B/Surfactant Protein B Antibody [NBP1-57977] - Human Lung Tissue Observed Staining: Cytoplasm and membrane of pneumocytes Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec.
Western Blot: SP-B/Surfactant Protein B Antibody [NBP1-57977]

Western Blot: SP-B/Surfactant Protein B Antibody [NBP1-57977]

Western Blot: SP-B/Surfactant Protein B Antibody [NBP1-57977] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.

Applications for SP-B/Surfactant Protein B Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SP-B/Surfactant Protein B

SFTPB is the pulmonary-associated surfactant B protein (SPB), an amphipathic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a lipid-rich material that prevents lung collapse by lowering surface tension at the air-liquid interface in the alveoli of lung. SPB enhances the rate of spreading and increases the stability of surfactant monolayers in vitro. Surfactant is composed of phospholipids and other surfactant-associated proteins. See also SFTPA1, SFTPC, and SFTPD. The SFTPB gene encodes the pulmonary-associated surfactant B protein (SPB), an amphipathic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a lipid-rich material that prevents lung collapse by lowering surface tension at the air-liquid interface in the alveoli of lung. SPB enhances the rate of spreading and increases the stability of surfactant monolayers in vitro. Surfactant is composed of phospholipids and other surfactant-associated proteins (Clark et al., 1995 [PubMed 7644495]). See also SFTPA1 (MIM 178630), SFTPC (MIM 178620), and SFTPD (MIM 178635).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Long Name

Surfactant Protein B

Alternate Names

PSP-B, SFTB3, SFTP3, SFTPB, SMDP1

Gene Symbol

SFTPB

UniProt

B2RC55 (Human)

Additional SP-B/Surfactant Protein B Products

Product Documents for SP-B/Surfactant Protein B Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for SP-B/Surfactant Protein B Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.