Spectrin alpha 1 Antibody (1U5K4)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16833

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-16833-100ul
NBP3-16833-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 1U5K4

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Spectrin alpha 1 Antibodies »

Product Summary for Spectrin alpha 1 Antibody (1U5K4)

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 2300-2400 of human Spectrin alpha 1 (P02549). LRGLNYYLPMVEEDEHEPKFEKFLDAVDPGRKGYVSLEDYTAFLIDKESENIKSSDEIENAFQALAEGKSYITKEDMKQALTPEQVSFCATHMQQYMDPRG

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Spectrin alpha 1 Antibody (1U5K4)

Western Blot: Spectrin alpha 1 Antibody (1U5K4) [NBP3-16833]

Western Blot: Spectrin alpha 1 Antibody (1U5K4) [NBP3-16833]

Western Blot: Spectrin alpha 1 Antibody (1U5K4) [NBP3-16833] - Western blot analysis of extracts of various cell lines, using Spectrin alpha 1 Rabbit mAb (NBP3-16833) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Applications for Spectrin alpha 1 Antibody (1U5K4)

Application
Recommended Usage

Western Blot

1:500 - 1:1000
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Spectrin alpha 1

Spectrin is a major constituent of the erythrocyte skeleton accounting for 25% of the total membrane protein and 75% of the cytoskeletal mass. It is associated with the cytoplasmic surface of the membrane by attachment to ankyrin, a peripheral membrane protein. The membrane skeleton influences several cellular properties such as cell shape, restriction of mobility of the integral membrane protein exposed at the cell surface and transmembrane movement of phospholipids and cholesterol. On SDS PAGE gels erythrocyte spectrin appears as two bands referred to as alpha (240 kDa) and beta (220 kDa). While the simplest form of spectrin in solution is an alpha-beta heterodimer, spectrin can undergo self-association in various conditions to form a tetramer of alpha2-beta2. In recent years a large number of spectrin-like molecules have been found in non-erythroid cells. These proteins are known by such different names as fodrin, CBP I, calspectin and TW 260/240.

Alternate Names

alpha-I spectrin, EL2, erythrocyte, HS3, spectrin, alpha, erythrocytic 1 (elliptocytosis 2)

Gene Symbol

SPTA1

Additional Spectrin alpha 1 Products

Product Documents for Spectrin alpha 1 Antibody (1U5K4)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Spectrin alpha 1 Antibody (1U5K4)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.