Spectrin beta 3 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-48703

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-48703
NBP2-48703-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all beta-III Spectrin Antibodies »

Product Summary for Spectrin beta 3 Antibody

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: PPPSTQAPSVNGVCTDGEPSQPLLGQQRLEHSSFPEGPGPGSGDEANGPRGERQTRTRGPAPSAMPQSRSTESAH

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Spectrin beta 3 Antibody

Immunocytochemistry/ Immunofluorescence: Spectrin beta 3 Antibody [NBP2-48703]

Immunocytochemistry/ Immunofluorescence: Spectrin beta 3 Antibody [NBP2-48703]

Immunocytochemistry/Immunofluorescence: Spectrin beta 3 Antibody [NBP2-48703] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: Spectrin beta 3 Antibody [NBP2-48703]

Immunohistochemistry-Paraffin: Spectrin beta 3 Antibody [NBP2-48703]

Immunohistochemistry-Paraffin: Spectrin beta 3 Antibody [NBP2-48703] - Staining in human skin and endometrium tissues using anti-SPTBN2 antibody. Corresponding SPTBN2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Spectrin beta 3 Antibody [NBP2-48703]

Immunohistochemistry-Paraffin: Spectrin beta 3 Antibody [NBP2-48703]

Immunohistochemistry-Paraffin: Spectrin beta 3 Antibody [NBP2-48703] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells, granular and molecular layer cells.
View 2 more images

Applications for Spectrin beta 3 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: beta-III Spectrin

Spectrins are principle components of a cell's membrane-cytoskeleton and are composed of two alpha and two beta spectrin subunits. The protein encoded by this gene (SPTBN2), is called spectrin beta non-erythrocytic 2 or beta-III spectrin. It is related to, but distinct from, the beta-II spectrin gene which is also known as spectrin beta non-erythrocytic 1 (SPTBN1). SPTBN2 regulates the glutamate signaling pathway by stabilizing the glutamate transporter EAAT4 at the surface of the plasma membrane.

Mutations in this gene cause a form of spinocerebellar ataxia, SCA5, that is characterized by neurodegeneration, progressive locomotor incoordination, dysarthria, and uncoordinated eye movements. Mutations in spectrins are a previously unknown cause of ataxia and neurodegenerative disease that affect membrane proteins involved in glutamate signaling. Spectrin-beta IIIs have been recognized as ataxia disease genes and their mutations cause spinocerebellar ataxia type 5 (SCA5).

Long Name

Spectrin Beta, Non-Erythrocytic 2

Alternate Names

GTRAP41, SCA5, SCAR14, Spectrin beta 3, Spectrin beta III, SPTBN2

Gene Symbol

SPTBN2

Additional beta-III Spectrin Products

Product Documents for Spectrin beta 3 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Spectrin beta 3 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.