SRPRB Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-59710

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-59710
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all SRPRB Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to SRPRB(signal recognition particle receptor, B subunit) The peptide sequence was selected from the middle region of SRPRB. Peptide sequence QDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLYSSSTAPAQLGKKGKE. The peptide sequence for this immunogen was taken from within the described region.

Specificity

This product is specific to Subunit or Isoform: beta.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SRPRB Antibody

Western Blot: SRPRB Antibody [NBP1-59710]

Western Blot: SRPRB Antibody [NBP1-59710]

Western Blot: SRPRB Antibody [NBP1-59710] - Jurkat, Antibody Dilution: 1.0 ug/ml SRPRB is supported by BioGPS gene expression data to be expressed in Jurkat.
Immunohistochemistry: SRPRB Antibody [NBP1-59710]

Immunohistochemistry: SRPRB Antibody [NBP1-59710]

Immunohistochemistry: SRPRB Antibody [NBP1-59710] - Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue Observed Staining: Cytoplasmic Primary Antibody Concentration: 1:100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec
Western Blot: SRPRB Antibody [NBP1-59710]

Western Blot: SRPRB Antibody [NBP1-59710]

Western Blot: SRPRB Antibody [NBP1-59710] - Hela cell lysate, concentration 0.2-1 ug/ml.
View 1 more images

Applications for SRPRB Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SRPRB

SRPRB has similarity to mouse protein which is a subunit of the signal recognition particle receptor (SR). This subunit is a transmembrane GTPase belonging to the GTPase superfamily. It anchors alpha subunit, a peripheral membrane GTPase, to the ER membrane. SR is required for the cotranslational targeting of both secretory and membrane proteins to the ER membrane.The protein encoded by this gene has similarity to mouse protein which is a subunit of the signal recognition particle receptor (SR). This subunit is a transmembrane GTPase belonging to the GTPase superfamily. It anchors alpha subunit, a peripheral membrane GTPase, to the ER membrane. SR is required for the cotranslational targeting of both secretory and membrane proteins to the ER membrane.The protein encoded by this gene has similarity to mouse protein which is a subunit of the signal recognition particle receptor (SR). This subunit is a transmembrane GTPase belonging to the GTPase superfamily. It anchors alpha subunit, a peripheral membrane GTPase, to the ER membrane. SR is required for the cotranslational targeting of both secretory and membrane proteins to the ER membrane.

Alternate Names

APMCF1, Protein APMCF1, signal recognition particle receptor subunit beta, signal recognition particle receptor, B subunit, signal recognition particle receptor, beta subunit, SR-beta

Gene Symbol

SRPRB

UniProt

Q9Y5M8 (Human)

Additional SRPRB Products

Product Documents for SRPRB Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for SRPRB Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.