SRY Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-82349

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-82349-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all SRY Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SRY. Peptide sequence: SEVQLDNRLYRDDCTKATHSRMEHQLGHLPPINAASSPQQRDRYSHWTKL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SRY Antibody

Western Blot: SRY Antibody [NBP2-82349]

Western Blot: SRY Antibody [NBP2-82349]

Western Blot: SRY Antibody [NBP2-82349] - Host: Rabbit. Target Name: SRY. Sample Type: HepG2. Antibody Dilution: 1.0ug/ml
Western Blot: SRY Antibody [NBP2-82349]

Western Blot: SRY Antibody [NBP2-82349]

Western Blot: SRY Antibody [NBP2-82349] - WB Suggested Anti-SRY Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: HepG2 cell lysate
Western Blot: SRY Antibody [NBP2-82349]

Western Blot: SRY Antibody [NBP2-82349]

Western Blot: SRY Antibody [NBP2-82349] - Host: Rabbit. Target Name: SRY. Sample Type: 721_B. Antibody Dilution: 1.0ug/mlSRY is supported by BioGPS gene expression data to be expressed in 721_B

Applications for SRY Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SRY

SRY encodes a transcription factor that is a member of the high mobility group (HMG)-box family of DNA-binding proteins. This protein is the testis-determining factor (TDF), which initiates male sex determination. Mutations in this gene give rise to XY females with gonadal dysgenesis (Swyer syndrome); translocation of part of the Y chromosome containing this gene to the X chromosome causes XX male syndrome.

Alternate Names

essential protein for sex determination in human males, sex determining region Y, sex-determining region on Y, sex-determining region Y protein, TDFsex determining region protein, TDY, Testis-determining factor

Gene Symbol

SRY

Additional SRY Products

Product Documents for SRY Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for SRY Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.