ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-69570

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-69570
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to ST3GAL2(ST3 beta-galactoside alpha-2,3-sialyltransferase 2) The peptide sequence was selected from the C terminal of ST3GAL2. Peptide sequence ADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody

Western Blot: ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody [NBP1-69570]

Western Blot: ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody [NBP1-69570]

Western Blot: ST3GAL2 Antibody [NBP1-69570] - This Anti-ST3GAL2 antibody was used in Western Blot of Fetal Heart tissue lysate at a concentration of 1ug/ml.

Applications for ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2

ST3GAL2 is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The protein is normally found in the Golgi but can be proteolytically processed to a soluble form. This protein, which is a member of glycosyltransferase family 29, can use the same acceptor substrates as does sialyltransferase 4A.The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein is normally found in the Golgi but can be proteolytically processed to a soluble form. This protein, which is a member of glycosyltransferase family 29, can use the same acceptor substrates as does sialyltransferase 4A.

Long Name

ST3 beta-Galactoside alpha-2,3-Sialyltransferase 2

Alternate Names

Alpha 2,3-ST 2, Sialyltransferase 4B, SIAT4B, ST3GalA.2

Gene Symbol

ST3GAL2

UniProt

Q16842 (Human)

Additional ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Products

Product Documents for ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.