STARD3 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-86834

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-86834
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all STARD3 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human STARD3. Peptide sequence: AVVDQILAQEENWKFEKNNEYGDTVYTIEVPFHGKTFILKTFLPCPAELV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for STARD3 Antibody

Western Blot: STARD3 Antibody [NBP2-86834]

Western Blot: STARD3 Antibody [NBP2-86834]

Western Blot: STARD3 Antibody [NBP2-86834] - Host: Rabbit. Target Name: STARD3. Sample Tissue: Human Leiomyosarcoma Tumor lysates. Antibody Dilution: 1ug/ml

Applications for STARD3 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: STARD3

The steroidogenic acute regulatory (StAR) protein facilitates the movement of cholesterol from the outer to inner mitochondrial membrane in adrenal and gonadal cells, fostering steroid biosynthesis. MLN 64 is a 445-amino acid protein of unknown function. When 218 amino-terminal residues of MLN 64 are deleted, the resulting N-218 MLN 64 has 37% amino acid identity with StAR and 50% of StAR's steroidogenic activity in transfected cells. Bacterially expressed N-218 MLN 64 exerts StAR-like activity to promote the transfer of cholesterol from the outer to inner mitochondrial membrane in vitro. The presence of a protease-resistant domain and a protease-sensitive carboxy-terminal domain in N-218 MLN 64 is similar to the organization of StAR. However, as MLN 64 never enters the mitochondria, the protease-resistant domain of MLN 64 cannot be a mitochondrial pause-transfer sequence, as has been proposed for StAR.

Alternate Names

CAB1, es64, Metastatic lymph node gene 64 protein, metastatic lymph node protein 64, MLN 64, MLN64FLJ41370, Protein CAB1, StARD3, StAR-related lipid transfer (START) domain containing 3, stAR-related lipid transfer protein 3, START domain containing 3, START domain-containing protein 3, steroidogenic acute regulatory protein related

Gene Symbol

STARD3

Additional STARD3 Products

Product Documents for STARD3 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for STARD3 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.