SYT17 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-85864

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-85864-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all SYT17 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse SYT17. Peptide sequence: AQTPPWLMASRSNDKDGDSVHTASDVPLTPRTNSPDGRRSSSDTSKSTYS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for SYT17 Antibody

Western Blot: SYT17 Antibody [NBP2-85864]

Western Blot: SYT17 Antibody [NBP2-85864]

Western Blot: SYT17 Antibody [NBP2-85864] - Host: Rabbit. Target Name: Syt17. Sample Type: Mouse Kidney lysates. Antibody Dilution: 1.0ug/ml

Applications for SYT17 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SYT17

The synaptotagmins are integral membrane proteins of synaptic vesicles thought to serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis. Calcium binding to synaptotagmin participates in triggering neurotransmitter release at the synapse. The first C2 domain mediates Ca(2+)-dependent phospholipid binding. The second C2 domain mediates interaction with Stonin 2. Synaptotagmin may have a regulatory role in the membrane interactions during trafficking of synaptic vesicles at the active zone of the synapse. It binds acidic phospholipids with a specificity that requires the presence of both an acidic head group and a diacyl backbone. A Ca(2+)-dependent interaction between synaptotagmin and putative receptors for activated protein kinase C has also been reported. It can bind to at least three additional proteins in a Ca(2+)-independent manner; these are neurexins, syntaxin and AP2.

Alternate Names

B/K protein, synaptotagmin XVIIProtein B/K, synaptotagmin-17, sytXVII

Gene Symbol

SYT17

Additional SYT17 Products

Product Documents for SYT17 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for SYT17 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.