TAF11 Antibody (3H5)

Novus Biologicals, part of Bio-Techne | Catalog # H00006882-M03

Submit a review

Product Datasheet / COA / SDS

Product Specifications
Scientific Data
Applications
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Species Reactivity

Human

Applications

ELISA, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Sandwich ELISA, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG₁ kappa Clone # 3H5

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all TAF11 Antibodies »

Product Specifications

Immunogen

TAF11 (NP_005634, 158 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SKVFVGEVVEEALDVCEKWGEMPPLQPKHMREAVRRLKSKGQIPNSKHKKIIF

Specificity

TAF11 (3H5)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG₁ kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for TAF11 Antibody (3H5)

Western Blot: TAF11 Antibody (3H5) [H00006882-M03]

Western Blot: TAF11 Antibody (3H5) [H00006882-M03] - Analysis of TAF11 expression in Hela S3 NE (Cat # L013V3).

Immunocytochemistry/ Immunofluorescence: TAF11 Antibody (3H5) [H00006882-M03]

Immunocytochemistry/Immunofluorescence: TAF11 Antibody (3H5) [H00006882-M03] - Analysis of monoclonal antibody to TAF11 on HeLa cell. Antibody concentration 10 ug/ml

Immunohistochemistry-Paraffin: TAF11 Antibody (3H5) [H00006882-M03]

Immunohistochemistry-Paraffin: TAF11 Antibody (3H5) [H00006882-M03] - Analysis of monoclonal antibody to TAF11 on formalin-fixed paraffin-embedded human smooth muscle. Antibody concentration 1.2 ug/ml

View 1 more images

Applications for TAF11 Antibody (3H5)

Application

Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry-Paraffin

Optimal dilutions of this antibody should be experimentally determined.

Sandwich ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.

Application Notes

Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.

Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: TAF11

Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes a small subunit of TFIID that is present in all TFIID complexes and interacts with TBP. This subunit also interacts with another small subunit, TAF13, to form a heterodimer with a structure similar to the histone core structure.

Alternate Names

28kDa, TAF(II)28, TAF11 RNA polymerase II, TATA box binding protein (TBP)-associated factor, TAF2IMGC:15243, TAFII-28, TAFII28TFIID subunit p30-beta, TATA box binding protein (TBP)-associated factor, RNA polymerase II, I, 28kD, transcription initiation factor TFIID 28 kD subunit, Transcription initiation factor TFIID 28 kDa subunit, transcription initiation factor TFIID subunit 11

Entrez Gene IDs

6882 (Human)

Gene Symbol

TAF11

OMIM

600772 (Human)

UniProt

NP_005634 (Human)

Additional TAF11 Products

Product Documents for TAF11 Antibody (3H5)

Product Datasheets

Download Product Datasheets

COA

SDS

Product Specific Notices for TAF11 Antibody (3H5)

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations
Reviews