TAS2R50 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-09537

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-09537-100ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all TAS2R50 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human TAS2R50 (NP_795371). Peptide sequence PFTLSLISFLMLICSLCKHLKKMQLHGEGSQDLSTKVHIKALQTLISFLL

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for TAS2R50 Antibody

Western Blot: TAS2R50 Antibody [NBP3-09537]

Western Blot: TAS2R50 Antibody [NBP3-09537]

Western Blot: TAS2R50 Antibody [NBP3-09537] - Western blot analysis of TAS2R50 in Fetal Lung as a positive control. Antibody dilution at 1.0 ug/ml

Applications for TAS2R50 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TAS2R50

TAS2R50 belongs to the large TAS2R receptor family. TAS2Rs are expressed on the surface of taste receptor cells and mediate the perception of bitterness through a G protein-coupled second messenger pathway. FUNCTION: Receptor that may play a role in the perception of bitterness and is gustducin-linked. May play a role in sensing the chemical composition of the gastrointestinal content. The activity of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation and lead to the gating of TRPM5. SUBCELLULAR LOCATION: Membrane; Multi-pass membrane protein. TISSUE SPECIFICITY: Expressed in subsets of taste receptor cells of the tongue and exclusively in gustducin-positive cells. MISCELLANEOUS: Most taste cells may be activated by a limited number of bitter compounds; individual taste cells can discriminate among bitter stimuli.

Alternate Names

T2R50Taste receptor type 2 member 51, T2R51MGC138305, TAS2R51, taste receptor type 2 member 50, taste receptor, type 2, member 50

Gene Symbol

TAS2R50

Additional TAS2R50 Products

Product Documents for TAS2R50 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for TAS2R50 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.