TBLR1 Antibody - Azide and BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-94126

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-94126-0.02ml
NBP2-94126-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all TBLR1 Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 120-170 of human TBLR1 (NP_078941.2). QQGSAKNGENTANGEENGAHTIANNHTDMMEVDGDVEIPPNKAVVLRGHES

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

55 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for TBLR1 Antibody - Azide and BSA Free

Western Blot: TBLR1 AntibodyAzide and BSA Free [NBP2-94126]

Western Blot: TBLR1 AntibodyAzide and BSA Free [NBP2-94126]

Western Blot: TBLR1 Antibody [NBP2-94126] - Western blot analysis of extracts of K-562 cells, using TBLR1 antibody (NBP2-94126) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.
Immunocytochemistry/ Immunofluorescence: TBLR1 Antibody - Azide and BSA Free [NBP2-94126]

Immunocytochemistry/ Immunofluorescence: TBLR1 Antibody - Azide and BSA Free [NBP2-94126]

Immunocytochemistry/Immunofluorescence: TBLR1 Antibody [NBP2-94126] - Immunofluorescence analysis of A549 cells using TBLR1 antibody (NBP2-94126).
Western Blot: TBLR1 AntibodyAzide and BSA Free [NBP2-94126]

Western Blot: TBLR1 AntibodyAzide and BSA Free [NBP2-94126]

Western Blot: TBLR1 Antibody [NBP2-94126] - Western blot analysis of extracts of Mouse brain, using TBLR1 antibody (NBP2-94126) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 180s.

Applications for TBLR1 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.09% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: TBLR1

TBLR1 is encoded by this gene has sequence similarity with members of the WD40 repeat-containing protein family. The WD40 group is a large family of proteins, which appear to have a regulatory function. It is believed that the WD40 repeats mediate protein-protein interactions and members of the family are involved in signal transduction, RNA processing, gene regulation, vesicular trafficking, cytoskeletal assembly and may play a role in the control of cytotypic differentiation.

Alternate Names

C21, DC42, F-box-like/WD repeat-containing protein TBL1XR1, FLJ12894, IRA1Transducin beta-like 1X-related protein 1, nuclear receptor co-repressor/HDAC3 complex subunit, Nuclear receptor corepressor/HDAC3 complex subunit TBLR1, TBLR1TBL1-related protein 1, transducin (beta)-like 1 X-linked receptor 1, transducin (beta)-like 1X-linked receptor 1

Gene Symbol

TBL1XR1

Additional TBLR1 Products

Product Documents for TBLR1 Antibody - Azide and BSA Free

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for TBLR1 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.