Tetraspanin-31 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-69339

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-69339
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all TSPAN31 Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to TSPAN31(tetraspanin 31) The peptide sequence was selected from the middle region of TSPAN31. Peptide sequence CTAICKSQSPTCQMCGEKFLKHSDEALKILGGVGLFFSFTEILGVWLAMR. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Tetraspanin-31 Antibody

Western Blot: Tetraspanin-31 Antibody [NBP1-69339]

Western Blot: Tetraspanin-31 Antibody [NBP1-69339]

Western Blot: Tetraspanin-31 Antibody [NBP1-69339] - This Anti-TSPAN31 antibody was used in Western Blot of Fetal Muscle tissue lysate at a concentration of 1ug/ml.

Applications for Tetraspanin-31 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TSPAN31

TSPAN31 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is thought to be involved in growth-related cellular processes. This gene is associated with tumorigenesis and osteosarcoma.The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is thought to be involved in growth-related cellular processes. This gene is associated with tumorigenesis and osteosarcoma.

Long Name

Tetraspanin 31

Alternate Names

SAS, Tetraspanin-31, Transmembrane 4 Protein

Gene Symbol

TSPAN31

UniProt

Q12999 (Human)

Additional TSPAN31 Products

Product Documents for Tetraspanin-31 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Tetraspanin-31 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.