Thyrotropin Releasing Hormone Antibody - Azide and BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-94348

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-94348-0.02ml
NBP2-94348-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Thyrotropin Releasing Hormone Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 143-242 of human Thyrotropin Releasing Hormone (NP_009048.1). WLAYAVPKRQHPGRRLADPKAQRSWEEEEEEEEREEDLMPEKRQHPGKRALGGPCGPQGAYGQAGLLLGLLDDLSRSQGAEEKRQHPGRRAAWVREPLEE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Thyrotropin Releasing Hormone Antibody - Azide and BSA Free

Western Blot: Thyrotropin Releasing Hormone AntibodyAzide and BSA Free [NBP2-94348]

Western Blot: Thyrotropin Releasing Hormone AntibodyAzide and BSA Free [NBP2-94348]

Western Blot: Thyrotropin Releasing Hormone Antibody [NBP2-94348] - Analysis of extracts of various cell lines, using Thyrotropin Releasing Hormone at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 90s.
Immunocytochemistry/ Immunofluorescence: Thyrotropin Releasing Hormone Antibody - Azide and BSA Free [NBP2-94348]

Immunocytochemistry/ Immunofluorescence: Thyrotropin Releasing Hormone Antibody - Azide and BSA Free [NBP2-94348]

Immunocytochemistry/Immunofluorescence: Thyrotropin Releasing Hormone Antibody [NBP2-94348] - Analysis of H9C2 cells using TRH Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: Thyrotropin Releasing Hormone Antibody - Azide and BSA Free [NBP2-94348]

Immunocytochemistry/ Immunofluorescence: Thyrotropin Releasing Hormone Antibody - Azide and BSA Free [NBP2-94348]

Immunocytochemistry/Immunofluorescence: Thyrotropin Releasing Hormone Antibody [NBP2-94348] - Analysis of U2OS cells using TRH Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.
View 1 more images

Applications for Thyrotropin Releasing Hormone Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50-1:200

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Thyrotropin Releasing Hormone

Functions as a regulator of the biosynthesis of TSH in the anterior pituitary gland and as a neurotransmitter/ neuromodulator in the central and peripheral nervous systems.

Alternate Names

MGC125964, MGC125965, prothyroliberin, thyrotropin-releasing hormone

Gene Symbol

TRH

Additional Thyrotropin Releasing Hormone Products

Product Documents for Thyrotropin Releasing Hormone Antibody - Azide and BSA Free

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Thyrotropin Releasing Hormone Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.