TIAL1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-79932

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-79932
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Zebrafish

Cited:

Fish - Danio rerio (Zebrafish)

Applications

Validated:

Immunocytochemistry/ Immunofluorescence, In-situ Hybridization, Western Blot

Cited:

Immunocytochemistry/ Immunofluorescence, In Situ Hybridization

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

1 mg/ml

View all TIAL1 Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the C terminal of human TIAL1The immunogen for this antibody is TIAL1. Peptide sequence WNQQGFGVDQSPSAAWMGGFGAQPPQGQAPPPVIPPPNQAGYGMASYQTQ. The peptide sequence for this immunogen was taken from within the described region.

Reactivity Notes

Zebrafish reactivity reported in scientific literature (PMIDs: 27489304 and 29975683).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for TIAL1 Antibody

Immunocytochemistry/ Immunofluorescence: TIAL1 Antibody [NBP1-79932]

Immunocytochemistry/ Immunofluorescence: TIAL1 Antibody [NBP1-79932]

Immunocytochemistry/Immunofluorescence: TIAL1 Antibody [NBP1-79932] - Immunofluorescence analyses of TIAL1 (h) against cytoplasmic opTDP-43h and opTDP-43hA315T aggregates at 120hpf. At least, twenty cells with distinct opTDP-43h or opTDP-43hA315T aggregates were examined for each of three independent fish. *p<0.0001, **p<0.0001, ***p=0.03 (unpaired t-test, two-tailed). The bars ndicate 5um. Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41467-020-14815-x), licensed under a CC-BY license.
Western Blot: TIAL1 Antibody [NBP1-79932]

Western Blot: TIAL1 Antibody [NBP1-79932]

Western Blot: TIAL1 Antibody [NBP1-79932] - Host: Rabbit. Target: TIAL1. Positive control (+): Mouse Spleen (M-SP). Negative control (-): Mouse Liver (M-LI). Antibody concentration: 2ug/ml
Western Blot: TIAL1 Antibody [NBP1-79932]

Western Blot: TIAL1 Antibody [NBP1-79932]

Western Blot: TIAL1 Antibody [NBP1-79932] - Titration: 1.25ug/ml Positive Control: Jurkat cell lysate.
View 1 more images

Applications for TIAL1 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Application Notes
Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID: 29975683). Use in In-situ Hybridization reported in scientific literature (PMID: 27489304).
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TIAL1

TIAL1 is encoded by this gene is a member of a family of RNA-binding proteins, has three RNA recognition motifs (RRMs), and binds adenine and uridine-rich elements in mRNA and pre-mRNAs of a wide range of genes. It regulates various activities including translational control, splicing and apoptosis. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. The different isoforms have been show to function differently with respect to post-transcriptional silencing.

Alternate Names

aging-associated gene 7 protein, MGC33401, TCBP, T-cluster binding protein, TIA1 cytotoxic granule-associated RNA binding protein-like 1, TIA1 cytotoxic granule-associated RNA-binding protein-like 1, TIA-1 related protein, TIA-1-related nucleolysin, TIA-1-related protein, TIARnucleolysin TIAR

Gene Symbol

TIAL1

UniProt

NP_003243 (Human)

Additional TIAL1 Products

Product Documents for TIAL1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for TIAL1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.