TLE4 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-88436

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-88436
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all TLE4 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human TLE4. Peptide sequence: GAEKHRNSADYSSESKKQKTEEKEIAARYDSDGEKSDDNLVVDVSNEDPS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for TLE4 Antibody

Western Blot: TLE4 Antibody [NBP2-88436]

Western Blot: TLE4 Antibody [NBP2-88436]

Western Blot: TLE4 Antibody [NBP2-88436] - WB Suggested Anti-TLE4 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: THP-1 cell lysate
Immunohistochemistry: TLE4 Antibody [NBP2-88436]

Immunohistochemistry: TLE4 Antibody [NBP2-88436]

Immunohistochemistry: TLE4 Antibody [NBP2-88436] - Testis

Applications for TLE4 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TLE4

The Notch signaling pathway controls cellular interactions important for the specification of a variety of fates in both invertebrates and vertebrates. Key players in the Notch pathway are the TLE genes (for transducin-like enhancer of split, also designated ESG for enhancer of split groucho), which are human homologs of the Drosophila groucho gene. Groucho is a transcriptional repressor that plays a key role in neurogenesis, segmentation and sex determination. TLEs associate with chromatin in live cells and specifically with Histone H3, but not with other core histones. Expression of the TLE genes, TLE1, TLE2, TLE3 and TLE4, correlate with immature epithelial cells that are progressing toward a terminally differentiated state, suggesting a role during epithelial differentiation. TLE1, TLE2 and TLE3 have elevated expression in cervial squamous metaplasias and carcinomas, while TLE4 is most highly expressed in the brain, particularly in the caudate nucleus. TLE1 and TLE4 contain SP and WD40 domains, through which TLE1 binds AML1 to inhibit AML1-induced transactivation of the CSF1 receptor. In early stages of cell differentiation, TLE1 is up-regulated, and TLE2 and TLE4 are down-regulated. In later stages, TLE2 and TLE4 are up-regulated, and expression of TLE1 decreases. TLE1 and TLE2 genes map in a tandem array at chromosomal location 19p13.3. The genetic loci for TLE3 and TLE4 are chromosomes 15q22 and 9, respectively.

Alternate Names

BCE1, BCE-1, E(spI), ESG4, homolog of Drosophila E(sp1), KIAA1261, Protein BCE-1, transducin-like enhancer of split 4 (E(sp1) homolog, Drosophila), transducin-like enhancer protein 4

Gene Symbol

TLE4

Additional TLE4 Products

Product Documents for TLE4 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for TLE4 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.