TMPRSS4 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-56991

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-56991
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all TMPRSS4 Antibodies »

Product Specifications

Immunogen

TMPRSS4 Antibody is a synthetic peptides corresponding to TMPRSS4 (transmembrane protease, serine 4) The peptide sequence was selected from the middle region of TMPRSS4. Peptide sequence LSGSLVSLHCLACGKSLKTPRVVGGEEASVDSWPWQVSIQYDKQHVCGGS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for TMPRSS4 Antibody

Western Blot: TMPRSS4 Antibody [NBP1-56991]

Western Blot: TMPRSS4 Antibody [NBP1-56991]

Western Blot: TMPRSS4 Antibody [NBP1-56991] - HepG2 cell lysate analyzed by Western blot at a concentration of 0.2-1 ug/ml. The observed molecular weight is represented by the band appearing at approximately 48 kDa.
Western Blot: TMPRSS4 Antibody [NBP1-56991]

Western Blot: TMPRSS4 Antibody [NBP1-56991]

Western Blot: TMPRSS4 Antibody [NBP1-56991] - Human breast cancer cell line SKBR3 and Positive control. Image from verified customer review. The observed molecular weight is represented at the band appearing at 48 kDa.

Applications for TMPRSS4 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Reviewed Applications

Read 1 review rated 5 using NBP1-56991 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TMPRSS4

TMPRSS4, previously known as TMPRSS3, is a 437 amino acid type II transmembrane serine protease located on human chromosome 11q23.3 that encodes 5 isoforms containing a complete coding sequence. This serine protease has a predicted molecular weight of 48 kDa with 2 glycosylation sites and the cleaved soluble protease domain has been detected in cell culture media. Functions of TMPRSS4 include embryo development, viral infection, and cancer. TMPRSS4 plays a role in the epithelial-mesenchymal transition (EMT) process and mediates cell invasion, migration, proliferation and metastasis. Overexpression of TMPRSS4 has been reported for multiple solid tumors including pancreatic, ovarian, thyroid, colorectal, lung, breast, cervical, gallbladder, gastric, and liver cancer, and has been associated with poor overall survival and reduced time to tumor progression (1,2).
TMPRSS4 has also been shown to play a role in the process of viral entry for coronaviruses and influenza viruses thru proteolytic activation of key viral glycoproteins. One pathway for SARS-CoV-2 infection, which causes the COVID-19 disease, involves binding of the SARS-CoV-2 Spike 'S' glycoprotein to the human ACE2 receptor and cleavage of S by TMPRSS2 or potentially by TMPRSS4 at the cell surface to facilitate viral entry (3).
References

1. L de Aberasturi A, Calvo A. (2015) TMPRSS4: An Emerging Potential Therapeutic Target in Cancer. Br J Cancer. 112(1):4-8. PMID: 25203520

2. Zeng P., Zhang P., Zhou L., Tang M., Shen Y., Jin J., Zhu Y., Chen M. (2016) TMPRSS4 as an emerging potential poor prognostic factor for solid tumors: A systematic review and meta-analysis. Oncotarget. 7:76327-76336. PMID: 27344186

3. Zang F, Castro MFG, McCune BT, Zeng Q, Rothlauf PW, Sonnek NM, Liu Z, Brulois KF, Wang X, Greenberg HB, Diamond MS, Ciorba MA, Whelan SPJ, and Ding S. (2020) TMPRSS2 and TMPRSS4 promote SARS-CoV-2 infection of human small intestinal enterocytes. Sci Immunol. 5(47): eabc3582. PMID: 32404436

Long Name

Transmembrane protease, serine 4

Alternate Names

CAPH2, MT-SP2

Gene Symbol

TMPRSS4

UniProt

Q9NRS4-2 (Human)

Additional TMPRSS4 Products

Product Documents for TMPRSS4 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for TMPRSS4 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.