TR beta 1/NR1A2/Thyroid Hormone Receptor beta Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-10413

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-10413-100ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Chromatin Immunoprecipitation (ChIP), Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all TR beta 1/NR1A2 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the n terminal region of mouse TR beta 1/NR1A2/Thyroid Hormone Receptor beta (NP_033406). Peptide sequence MNYCMPEVHEVCPAASSNCYMQVTDYLAYLEDSPALSGRDVQAVPSSSIY

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for TR beta 1/NR1A2/Thyroid Hormone Receptor beta Antibody

Western Blot: TR beta 1/NR1A2/Thyroid Hormone Receptor beta Antibody [NBP3-10413]

Western Blot: TR beta 1/NR1A2/Thyroid Hormone Receptor beta Antibody [NBP3-10413]

Western Blot: TR beta 1/NR1A2/Thyroid Hormone Receptor beta Antibody [NBP3-10413] - WB Suggested Anti-Thrb Antibody Titration: 0.2-1 ug/ml. Positive Control: Mouse Muscle

Applications for TR beta 1/NR1A2/Thyroid Hormone Receptor beta Antibody

Application
Recommended Usage

Chromatin Immunoprecipitation (ChIP)

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TR beta 1/NR1A2

Thyroid Hormone Receptor beta is encoded by this gene is a nuclear hormone receptor for triiodothyronine. It is one of the several receptors for thyroid hormone, and has been shown to mediate the biological activities of thyroid hormone. Knockout studies in mice suggest that the different receptors, while having certain extent of redundancy, may mediate different functions of thyroid hormone. Defects in this gene are known to be a cause of generalized thyroid hormone resistance (GTHR), a syndrome characterized by goiter and high levels of circulating thyroid hormone (T3-T4), with normal or slightly elevated thyroid stimulating hormone (TSH).

Long Name

Thyroid Hormone Receptor beta 1

Alternate Names

NR1A2, THRB, v-ErbA2

Gene Symbol

THRB

Additional TR beta 1/NR1A2 Products

Product Documents for TR beta 1/NR1A2/Thyroid Hormone Receptor beta Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for TR beta 1/NR1A2/Thyroid Hormone Receptor beta Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.