TRAR4 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-86871

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-86871
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Monkey

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all TRAR4 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human TRAR4. Peptide sequence: YGNIFLVARRQAKKIENTGSKTESSSESYKARVARRERKAAKTLGVTVVA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for TRAR4 Antibody

Western Blot: TRAR4 Antibody [NBP2-86871]

Western Blot: TRAR4 Antibody [NBP2-86871]

Western Blot: TRAR4 Antibody [NBP2-86871] - WB Suggested Anti-TAAR6 Antibody. Titration: 1.0 ug/ml. Positive Control: A549 Whole Cell
Immunohistochemistry: TRAR4 Antibody [NBP2-86871]

Immunohistochemistry: TRAR4 Antibody [NBP2-86871]

Immunohistochemistry: TRAR4 Antibody [NBP2-86871] - Researcher: Timur Mavlyutov, University of Wisconsin Medical School. Application: IHC. Species+tissue/cell type: Ventral horn region of mouse spinal cord. Primary antibody dilution: 1:200. Secondary antibody: Donkey anti-rabbit CY2. Secondary antibody dilution:1:500
Immunohistochemistry: TRAR4 Antibody [NBP2-86871]

Immunohistochemistry: TRAR4 Antibody [NBP2-86871]

Immunohistochemistry: TRAR4 Antibody [NBP2-86871] - Researcher:Timur Mavlyutov, Ph. D., University of Wisconsin Medical School. Application: IHC. Species+tissue/cell type:Rhesus macaque spinal cord. Primary antibody dilution: 1:300. Secondary antibody: Donkey anti Rabbit 488. Secondary antibody dilution: 1:500

Applications for TRAR4 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TRAR4

FUNCTION: Orphan receptor. Could be a receptor for trace amines. Trace amines are biogenic amines present in very low levels in mammalian tissues. Although some trace amines have clearly defined roles as neurotransmitters in invertebrates, the extent to which they function as true neurotransmitters in vertebrates has remained speculative. Trace amines are likely to be involved in a variety of physiological functions that have yet to be fully understood. SUBCELLULAR LOCATION: Cell membrane; Multi-pass membrane protein. TISSUE SPECIFICITY: Expressed at low abundance in various brain tissues, as well as in fetal liver, but not in the cerebellum or placenta. In the brain, comparable levels of expression in basal ganglia, frontal cortex, substantia nigra, amygdala and hippocampus, highest expression in hippocampus and lowest expression in basal ganglia.

Alternate Names

RP11-295F4.3, TA4taR-6, TAR4, TaR-4, TAR6, TaR-6, trace amine associated receptor 6, Trace amine receptor 4taR-4, Trace amine receptor 6, TRAR4trace amine-associated receptor 6

Gene Symbol

TAAR6

Additional TRAR4 Products

Product Documents for TRAR4 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for TRAR4 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.