TRIM10 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-85982

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-85982-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

1 mg/ml

View all TRIM10 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human TRIM10. Peptide sequence: RVSLDYEVGWVTFTNAVTREPIYTFTASFTRKVIPFFGLWGRGSSFSLSS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for TRIM10 Antibody

Western Blot: TRIM10 Antibody [NBP2-85982]

Western Blot: TRIM10 Antibody [NBP2-85982]

Western Blot: TRIM10 Antibody [NBP2-85982] - Host: Rabbit. Target Name: TRIM10. Sample Type: Human Fetal Heart. Antibody Dilution: 1.0ug/ml
Western Blot: TRIM10 Antibody [NBP2-85982]

Western Blot: TRIM10 Antibody [NBP2-85982]

Western Blot: TRIM10 Antibody [NBP2-85982] - WB Suggested Anti-TRIM10 Antibody Titration: 5.0ug/ml. ELISA Titer: 1:2500. Positive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that TRIM10 is expressed in HepG2
Western Blot: TRIM10 Antibody [NBP2-85982]

Western Blot: TRIM10 Antibody [NBP2-85982]

Western Blot: TRIM10 Antibody [NBP2-85982] - Host: Rabbit. Target Name: TRIM10. Sample Type: Human Fetal Kidney. Antibody Dilution: 1.0ug/ml
View 6 more images

Applications for TRIM10 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TRIM10

TRIM10 is encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to cytoplasmic bodies. Studies in mice suggest that this protein plays a role in terminal differentiation of erythroid cells. Alternate splicing of this gene generates two transcript variants encoding different isoforms. [provided by RefSeq]

Alternate Names

B30-RING finger protein, HERF1hematopoietic RING finger 1, RFB30MGC141979, RING finger protein 9, RNF9tripartite motif protein 10, tripartite motif containing 10, tripartite motif-containing 10, tripartite motif-containing protein 10, Zn-finger protein

Gene Symbol

TRIM10

Additional TRIM10 Products

Product Documents for TRIM10 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for TRIM10 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.