Troponin C (cardiac) Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-55151

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-55151
NBP2-55151-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all Troponin C (cardiac) Antibodies »

Product Summary for Troponin C (cardiac) Antibody

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVM

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Troponin C (cardiac) Antibody

Immunohistochemistry-Paraffin: Troponin C (cardiac) Antibody [NBP2-55151]

Immunohistochemistry-Paraffin: Troponin C (cardiac) Antibody [NBP2-55151]

Immunohistochemistry-Paraffin: Troponin C (cardiac) Antibody [NBP2-55151] - Staining in human heart muscle and prostate tissues using anti-TNNC1 antibody. Corresponding TNNC1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Troponin C (cardiac) Antibody [NBP2-55151]

Immunohistochemistry-Paraffin: Troponin C (cardiac) Antibody [NBP2-55151]

Immunohistochemistry-Paraffin: Troponin C (cardiac) Antibody [NBP2-55151] - Staining of human heart muscle, liver, prostate and skeletal muscle using Anti-TNNC1 antibody NBP2-55151 (A) shows similar protein distribution across tissues to independent antibody NBP2-37958 (B).
Immunocytochemistry/ Immunofluorescence: Troponin C (cardiac) Antibody [NBP2-55151]

Immunocytochemistry/ Immunofluorescence: Troponin C (cardiac) Antibody [NBP2-55151]

Immunocytochemistry/Immunofluorescence: Troponin C (cardiac) Antibody [NBP2-55151] - Staining of human cell line HeLa shows localization to nucleoplasm, mitochondria & actin filaments. Antibody staining is shown in green.
View 4 more images

Applications for Troponin C (cardiac) Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:2500 - 1:5000

Immunohistochemistry-Paraffin

1:2500 - 1:5000
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-P Retrieval method: HIER pH6.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Troponin C (cardiac)

Troponin I is part of a heteromeric complex playing an important role in the regulation of skeletal and cardiac muscle contraction. It consists of three subunits, troponin I (TnI), troponin T (TnT) and troponin C (TnC). Each subunit is responsible for part of troponin complex function. TnI inhibits ATPase activity of acto myosin and TnT and TnI are present in cardiac muscles in different forms than in skeletal muscles. Only one tissue specific isoform of TnI is described for cardiac muscle tissue (cTnI) and this is expressed only in myocardium.

Alternate Names

cardiac troponin C, CMD1Z, CMH13, slow twitch skeletal/cardiac muscle troponin C, TNC, TN-C, TNNC, troponin C type 1 (slow), troponin C, slow, troponin C, slow skeletal and cardiac muscles, troponin C1, slow

Gene Symbol

TNNC1

Additional Troponin C (cardiac) Products

Product Documents for Troponin C (cardiac) Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Troponin C (cardiac) Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.