Troponin T type 1 (slow skeletal) Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-54820

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-54820
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all Troponin T type 1 (slow skeletal) Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to Troponin T type 1 (slow skeletal) The peptide sequence was selected from the middle region of Troponin T type 1 (slow skeletal) Peptide sequence WIHQLESEKFDLMAKLKQQKYEINVLYNRISHAQKFRKGAGKGRVGGRWK. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Troponin T type 1 (slow skeletal) Antibody

Western Blot: Troponin T type 1 (slow skeletal) Antibody [NBP1-54820]

Western Blot: Troponin T type 1 (slow skeletal) Antibody [NBP1-54820]

Western Blot: Troponin T type 1 (slow skeletal) Antibody [NBP1-54820] - Human Muscle lysate, concentration 0.2-1 ug/ml.

Applications for Troponin T type 1 (slow skeletal) Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Troponin T type 1 (slow skeletal)

Troponin T type 1 (slow skeletal) is a protein that is a subunit of troponin, which is a regulatory complex located on the thin filament of the sarcomere. This complex regulates striated muscle contraction in response to fluctuations in intracellular calcium concentration. This complex is composed of three subunits: troponin C, which binds calcium, troponin T, which binds tropomyosin, and troponin I, which is an inhibitory subunit. This protein is the slow skeletal troponin T subunit. Mutations in this gene cause nemaline myopathy type 5, also known as Amish nemaline myopathy, a neuromuscular disorder characterized by muscle weakness and rod-shaped, or nemaline, inclusions in skeletal muscle fibers which affects infants, resulting in death due to respiratory insufficiency, usually in the second year.This gene encodes a protein that is a subunit of troponin, which is a regulatory complex located on the thin filament of the sarcomere. This complex regulates striated muscle contraction in response to fluctuations in intracellular calcium concentration. This complex is composed of three subunits: troponin C, which binds calcium, troponin T, which binds tropomyosin, and troponin I, which is an inhibitory subunit. This protein is the slow skeletal troponin T subunit. Mutations in this gene cause nemaline myopathy type 5, also known as Amish nemaline myopathy, a neuromuscular disorder characterized by muscle weakness and rod-shaped, or nemaline, inclusions in skeletal muscle fibers which affects infants, resulting in death due to respiratory insufficiency, usually in the second year. Multiple transcript variants encoding different isoforms have been found for this gene.

Alternate Names

ANMtroponin T, slow skeletal muscle, FLJ98147, MGC104241, Slow skeletal muscle troponin T, sTnT, TNTS, TNTtroponin T1, skeletal, slow, troponin T type 1 (skeletal, slow), troponin-T1, skeletal, slow

Gene Symbol

TNNT1

UniProt

P13805 (Human)

Additional Troponin T type 1 (slow skeletal) Products

Product Documents for Troponin T type 1 (slow skeletal) Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Troponin T type 1 (slow skeletal) Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.