Tyrosylprotein Sulfotransferase 2/TPST2 Antibody - Azide and BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-03879

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-03879
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Tyrosylprotein Sulfotransferase 2/TPST2 Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 280-370 of human Tyrosylprotein Sulfotransferase 2/TPST2 (NP_003586.3). SKIERSTDQVIKPVNLEALSKWTGHIPGDVVRDMAQIAPMLAQLGYDPYANPPNYGNPDPFVINNTQRVLKGDYKTPANLKGYFQVNQNST

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Tyrosylprotein Sulfotransferase 2/TPST2 Antibody - Azide and BSA Free

Western Blot: Tyrosylprotein Sulfotransferase 2/TPST2 AntibodyAzide and BSA Free [NBP3-03879]

Western Blot: Tyrosylprotein Sulfotransferase 2/TPST2 AntibodyAzide and BSA Free [NBP3-03879]

Western Blot: Tyrosylprotein Sulfotransferase 2/TPST2 Antibody [NBP3-03879] - Western blot analysis of extracts of various cell lines, using TPST2 antibody (NBP3-03879) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.

Applications for Tyrosylprotein Sulfotransferase 2/TPST2 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:100 - 1:500

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS with 50% glycerol, pH7.3.

Format

Azide and BSA Free

Preservative

0.05% Proclin 300

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Tyrosylprotein Sulfotransferase 2/TPST2

The protein encoded by the TPST2 gene catalyzes the O-sulfation of tyrosine residues within acidic regions of proteins. The encoded protein is a type II integral membrane protein found in the Golgi body. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]. Transcript Variant: This variant (1) represents the longer transcript. Variants 1 and 2 both encode the same protein.

Alternate Names

Tyrosylprotein Sulfotransferase 2

Gene Symbol

TPST2

Additional Tyrosylprotein Sulfotransferase 2/TPST2 Products

Product Documents for Tyrosylprotein Sulfotransferase 2/TPST2 Antibody - Azide and BSA Free

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Tyrosylprotein Sulfotransferase 2/TPST2 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.