TZFP Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-79984

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-79984
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all TZFP Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the N terminal of human ZBTB32. Peptide sequence PIRLPSPYGSDRLVQLAARLRPALCDTLITVGSQEFPAHSLVLAGVSQQL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for TZFP Antibody

Western Blot: TZFP Antibody [NBP1-79984]

Western Blot: TZFP Antibody [NBP1-79984]

Western Blot: TZFP Antibody [NBP1-79984] - Host: Rabbit. Target Name: WT1. Sample Type: 721_B. Antibody Dilution: 1.0ug/mlZBTB32 is supported by BioGPS gene expression data to be expressed in 721_B
Western Blot: TZFP Antibody [NBP1-79984]

Western Blot: TZFP Antibody [NBP1-79984]

Western Blot: TZFP Antibody [NBP1-79984] - Human 721_B.
Western Blot: TZFP Antibody [NBP1-79984]

Western Blot: TZFP Antibody [NBP1-79984]

Western Blot: TZFP Antibody [NBP1-79984] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
View 1 more images

Applications for TZFP Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TZFP

DNA-binding protein that binds to the to a 5'-TGTACAGTGT-3' core sequence. May function as a transcriptional transactivator and transcriptional repressor. Probably exerts its repressor effect by preventing GATA3 from binding to DNA. May play a role in regulating the differentiation and activation of helper T cells

Alternate Names

Fanconi anemia zinc finger protein, FAXF, FAZFFANCC-interacting protein, Rog, Testis zinc finger protein, TZFPZinc finger protein 538, zinc finger and BTB domain containing 32, zinc finger and BTB domain-containing protein 32, ZNF538FAXFrepressor of GATA

Gene Symbol

ZBTB32

Additional TZFP Products

Product Documents for TZFP Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for TZFP Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.