UBE2N/Ubc13 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-48823

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-48823
NBP2-48823-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all UBE2N/Ubc13 Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: IIKETQRLLAEPVPGIKAEPDESNARYFHVVIA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for UBE2N/Ubc13 Antibody

Western Blot: UBE2N/Ubc13 Antibody [NBP2-48823]

Western Blot: UBE2N/Ubc13 Antibody [NBP2-48823]

Western Blot: UBE2N/Ubc13 Antibody [NBP2-48823] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue
Immunocytochemistry/ Immunofluorescence: UBE2N/Ubc13 Antibody [NBP2-48823]

Immunocytochemistry/ Immunofluorescence: UBE2N/Ubc13 Antibody [NBP2-48823]

Immunocytochemistry/Immunofluorescence: UBE2N/Ubc13 Antibody [NBP2-48823] - Immunofluorescent staining of human cell line RT4 shows localization to nucleus.
Immunohistochemistry-Paraffin: UBE2N/Ubc13 Antibody [NBP2-48823]

Immunohistochemistry-Paraffin: UBE2N/Ubc13 Antibody [NBP2-48823]

Immunohistochemistry-Paraffin: UBE2N/Ubc13 Antibody [NBP2-48823] - Staining in human testis and pancreas tissues using anti-UBE2N antibody. Corresponding UBE2N RNA-seq data are presented for the same tissues.
View 2 more images

Applications for UBE2N/Ubc13 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: UBE2N/Ubc13

UBC13 is a member of the E2 ubiquitin-conjugating enzyme family also known as Ubiquitin-conjugating enzyme E2 N, Ubiquitin-protein ligase N, Ubiquitin carrier protein N and Bendless-like ubiquitin-conjugating enzyme. The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. UBC13 forms a heterodimer with UBE2V2 which then catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through Lys-63. This type of poly-ubiquitination does not lead to protein degradation by the proteasome. UBC13 also mediates transcriptional activation of target genes and plays a role in the control of progress through the cell cycle and differentiation, as well as error-free DNA repair. UBC13 also contributes to the survival of cells after DNA damage.

Alternate Names

BLU, UBC13, UbcH13, UBE2N

Gene Symbol

UBE2N

Additional UBE2N/Ubc13 Products

Product Documents for UBE2N/Ubc13 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for UBE2N/Ubc13 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.