Ubiquitin-activating Enzyme/UBE1 Antibody (6H2I9)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16792

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-16792-100ul
NBP3-16792-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 6H2I9

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Ubiquitin-activating Enzyme/UBE1 Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 959-1058 of human Ubiquitin-activating Enzyme/UBE1 (P22314). EVQGLQPNGEEMTLKQFLDYFKTEHKLEITMLSQGVSMLYSFFMPAAKLKERLDQPMTEIVSRVSKRKLGRHVRALVLELCCNDESGEDVEVPYVRYTIR

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Ubiquitin-activating Enzyme/UBE1 Antibody (6H2I9)

Western Blot: Ubiquitin-activating Enzyme/UBE1 Antibody (6H2I9) [NBP3-16792]

Western Blot: Ubiquitin-activating Enzyme/UBE1 Antibody (6H2I9) [NBP3-16792]

Western Blot: Ubiquitin-activating Enzyme/UBE1 Antibody (6H2I9) [NBP3-16792] - Western blot analysis of extracts of various cell lines, using Ubiquitin-activating Enzyme/UBE1 Rabbit mAb (NBP3-16792) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunocytochemistry/ Immunofluorescence: Ubiquitin-activating Enzyme/UBE1 Antibody (6H2I9) [NBP3-16792]

Immunocytochemistry/ Immunofluorescence: Ubiquitin-activating Enzyme/UBE1 Antibody (6H2I9) [NBP3-16792]

Immunocytochemistry/Immunofluorescence: Ubiquitin-activating Enzyme/UBE1 Antibody (6H2I9) [NBP3-16792] - Immunofluorescence analysis of U-2 OS cells using Ubiquitin-activating Enzyme/UBE1 Rabbit mAb (NBP3-16792) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: Ubiquitin-activating Enzyme/UBE1 Antibody (6H2I9) [NBP3-16792]

Immunohistochemistry-Paraffin: Ubiquitin-activating Enzyme/UBE1 Antibody (6H2I9) [NBP3-16792]

Immunohistochemistry-Paraffin: Ubiquitin-activating Enzyme/UBE1 Antibody (6H2I9) [NBP3-16792] - Immunohistochemistry of paraffin-embedded human esophageal using Ubiquitin-activating Enzyme/UBE1 Rabbit mAb (NBP3-16792) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Applications for Ubiquitin-activating Enzyme/UBE1 Antibody (6H2I9)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Ubiquitin-activating Enzyme/UBE1

E1 Ubiquitin Activating Enzyme is encoded by this gene catalyzes the first step in ubiquitin conjugation to mark cellular proteins for degradation. This gene complements an X-linked mouse temperature-sensitive defect in DNA synthesis, and thus may function in DNA repair. It is part of a gene cluster on chromosome Xp11.23. Alternatively spliced transcript variants that encode the same protein have been described.

Alternate Names

A1S9T, AMCX1, GXP1, POC20, SMAX2, UBA1, UBE1, Ubiquitinactivating Enzyme

Gene Symbol

UBA1

Additional Ubiquitin-activating Enzyme/UBE1 Products

Product Documents for Ubiquitin-activating Enzyme/UBE1 Antibody (6H2I9)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Ubiquitin-activating Enzyme/UBE1 Antibody (6H2I9)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.