UBR1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-54976

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-54976
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all UBR1 Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to UBR1(ubiquitin protein ligase E3 component n-recognin 1) The peptide sequence was selected from the N terminal of UBR1. Peptide sequence YKQLQKEYISDDHDRSISITALSVQMFTVPTLARHLIEEQNVISVITETL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

200 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for UBR1 Antibody

Western Blot: UBR1 Antibody [NBP1-54976]

Western Blot: UBR1 Antibody [NBP1-54976]

Western Blot: UBR1 Antibody [NBP1-54976] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.

Applications for UBR1 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: UBR1

UBR1 is an E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. Recognizes and binds to proteins bearing specific N-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation. UBR1 may be involved in pancreatic homeostasis.The N-end rule pathway is one proteolytic pathway of the ubiquitin system. The recognition component of this pathway, encoded by this gene, binds to a destabilizing N-terminal residue of a substrate protein and participates in the formation of a substrate-linked multiubiquitin chain. This leads to the eventual degradation of the substrate protein. The protein described in this record has a RING-type zinc finger and a UBR-type zinc finger. Mutations in this gene have been associated with Johanson-Blizzard syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

E3 ubiquitin-protein ligase UBR1, E3a ligase, EC 6.3.2.-, JBS, MGC142065, MGC142067, N-recognin-1, ubiquitin ligase E3 alpha-I, ubiquitin protein ligase E3 component n-recognin 1, ubiquitin-protein ligase E3-alpha, Ubiquitin-protein ligase E3-alpha-1, Ubiquitin-protein ligase E3-alpha-I

Gene Symbol

UBR1

UniProt

Q8IWV7 (Human)

Additional UBR1 Products

Product Documents for UBR1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for UBR1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.