VKORC1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-83750

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-83750-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all VKORC1 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of VKORC1. Peptide sequence: LHVKAARARDRDYRALCDVGTAISCSRVFSSRLPADTLGLCPDAAELPGV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for VKORC1 Antibody

Western Blot: VKORC1 Antibody [NBP2-83750]

Western Blot: VKORC1 Antibody [NBP2-83750]

Western Blot: VKORC1 Antibody [NBP2-83750] - WB Suggested Anti-VKORC1 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Brain
Immunohistochemistry-Paraffin: VKORC1 Antibody [NBP2-83750]

Immunohistochemistry-Paraffin: VKORC1 Antibody [NBP2-83750]

Immunohistochemistry-Paraffin: VKORC1 Antibody [NBP2-83750] - Rabbit Anti-VKORC1 Antibody. Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue. Observed Staining: Cytoplasmic. Primary Antibody Concentration: 1:100. Other Working Concentrations: N/A. Secondary Antibody: Donkey anti-Rabbit-Cy3. Secondary Antibody Concentration: 1:200. Magnification: 20X. Exposure Time: 0.5 - 2.0 sec

Applications for VKORC1 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: VKORC1

Vitamin K is essential for blood clotting but must be enzymatically activated. This enzymatically activated form of vitamin K is a reduced form required for the carboxylation of glutamic acid residues in some blood-clotting proteins. The product of this gene encodes the enzyme that is responsible for reducing vitamin K 2,3-epoxide to the enzymatically activated form. Fatal bleeding can be caused by vitamin K deficiency and by the vitamin K antagonist warfarin, and it is the product of this gene that is sensitive to warfarin. In humans, mutations in this gene can be associated with deficiencies in vitamin-K-dependent clotting factors and, in humans and rats, with warfarin resistance. Two pseudogenes have been identified on chromosome 1 and the X chromosome. Two alternatively spliced transcripts encoding different isoforms have been described. [provided by RefSeq]

Alternate Names

EC 1.1.4.1, EDTP308, FLJ00289, IMAGE3455200, MST576, phylloquinone epoxide reductase, vitamin K dependent clMST134, vitamin K epoxide reductase complex subunit 1, vitamin K epoxide reductase complex, subunit 1, Vitamin K1 2,3-epoxide reductase subunit 1, vitamin K1 epoxide reductase (warfarin-sensitive), VKCFD2, VKORMGC2694

Gene Symbol

VKORC1

Additional VKORC1 Products

Product Documents for VKORC1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for VKORC1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.