WW domain binding protein 5 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-83764

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-83764-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all WW domain binding protein 5 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human WW domain binding protein 5. Peptide sequence: QKMEGKPENESEPKHEEEPKPEEKPEEEEKLEEEAKAKGTFRERLIQSLQ The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for WW domain binding protein 5 Antibody

Western Blot: WW domain binding protein 5 Antibody [NBP2-83764]

Western Blot: WW domain binding protein 5 Antibody [NBP2-83764]

Western Blot: WW domain binding protein 5 Antibody [NBP2-83764] - Host: Rabbit. Target Name: WBP5. Sample Tissue: Human HCT116 Whole Cell. Antibody Dilution: 3ug/ml
Western Blot: WW domain binding protein 5 Antibody [NBP2-83764]

Western Blot: WW domain binding protein 5 Antibody [NBP2-83764]

Western Blot: WW domain binding protein 5 Antibody [NBP2-83764] - Host: Rabbit. Target Name: WBP5. Sample Type: Jurkat Whole Cell lysates. Antibody Dilution: 1.0ug/ml
Western Blot: WW domain binding protein 5 Antibody [NBP2-83764]

Western Blot: WW domain binding protein 5 Antibody [NBP2-83764]

Western Blot: WW domain binding protein 5 Antibody [NBP2-83764] - Host: Rabbit. Target Name: WBP5. Sample Tissue: Human K562 Whole Cell. Antibody Dilution: 5ug/ml

Applications for WW domain binding protein 5 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: WW domain binding protein 5

The globular WW domain is composed of 38 to 40 semiconserved amino acids shared by proteins of diverse functions including structural, regulatory, and signaling proteins. The domain is involved in mediating protein-protein interactions through the binding of polyproline ligands. This gene encodes a WW domain binding protein. This gene also encodes a domain with similarity to the transcription elongation factor A, SII-related family. Alternative splicing results in multiple transcript variants encoding a single isoform. Transcript Variant: This variant (1) represents the longest transcript. Variants 1 through 4 encode the same isoform.

Alternate Names

DKFZp313K1940, N4, NDFIP1, pp21 homolog, TCEAL9, WBP-5, WW domain binding protein 1, WW domain binding protein 5, WW domain-binding protein 5

Gene Symbol

TCEAL9

Additional WW domain binding protein 5 Products

Product Documents for WW domain binding protein 5 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for WW domain binding protein 5 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.