XK X-linked Kx blood group Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-87828

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-87828
NBP1-87828-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all XK X-linked Kx blood group Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: DLSRDRPLVLLLHLLQLGPLFRCFEVFCIYFQSGNNEEPYVSITKKRQMPKNGLSEEIEKEVGQAEGKLITHRSAFSRA

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (87%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for XK X-linked Kx blood group Antibody

Immunocytochemistry/ Immunofluorescence: XK X-linked Kx blood group Antibody [NBP1-87828]

Immunocytochemistry/ Immunofluorescence: XK X-linked Kx blood group Antibody [NBP1-87828]

Immunocytochemistry/Immunofluorescence: XK X-linked Kx blood group Antibody [NBP1-87828] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & mitochondria.
Immunohistochemistry-Paraffin: XK X-linked Kx blood group Antibody [NBP1-87828]

Immunohistochemistry-Paraffin: XK X-linked Kx blood group Antibody [NBP1-87828]

Immunohistochemistry-Paraffin: XK X-linked Kx blood group Antibody [NBP1-87828] - Staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes.
Immunocytochemistry/ Immunofluorescence: XK X-linked Kx blood group Antibody [NBP1-87828]

Immunocytochemistry/ Immunofluorescence: XK X-linked Kx blood group Antibody [NBP1-87828]

Immunocytochemistry/Immunofluorescence: XK X-linked Kx blood group Antibody [NBP1-87828] - Staining of human cell line U-2 OS shows positivity in mitochondria and vesicles.
View 4 more images

Applications for XK X-linked Kx blood group Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: XK X-linked Kx blood group

This locus controls the synthesis of the Kell blood group 'precursor substance' (Kx). Mutations in this gene have been associated with McLeod syndrome, an X-linked, recessive disorder characterized by abnormalities in the neuromuscular and hematopoietic systems. The encoded protein has structural characteristics of prokaryotic and eukaryotic membrane transport proteins. (provided by RefSeq)

Alternate Names

Kell blood group precursor (McLeod phenotype), Kell complex 37 kDa component, Kx, Kx antigen, membrane transport protein XK, X1k, XK, Kell blood group complex subunit (McLeod syndrome), XKR1XK-related protein 1, X-linked Kx blood group (McLeod syndrome), XRG1

Gene Symbol

XK

Additional XK X-linked Kx blood group Products

Product Documents for XK X-linked Kx blood group Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for XK X-linked Kx blood group Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.