XK X-linked Kx blood group Antibody - Azide and BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-93011

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-93011-0.02ml
NBP2-93011-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all XK X-linked Kx blood group Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 59-138 of human XK (NP_066569.1). HRDLSRDRPLVLLLHLLQLGPLFRCFEVFCIYFQSGNNEEPYVSITKKRQMPKNGLSEEIEKEVGQAEGKLITHRSAFSR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

50 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for XK X-linked Kx blood group Antibody - Azide and BSA Free

Western Blot: XK X-linked Kx blood group AntibodyAzide and BSA Free [NBP2-93011]

Western Blot: XK X-linked Kx blood group AntibodyAzide and BSA Free [NBP2-93011]

Western Blot: XK X-linked Kx blood group Antibody [NBP2-93011] - Analysis of extracts of various cell lines, using XK X-linked Kx blood group at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 1s.
Immunocytochemistry/ Immunofluorescence: XK X-linked Kx blood group Antibody - Azide and BSA Free [NBP2-93011]

Immunocytochemistry/ Immunofluorescence: XK X-linked Kx blood group Antibody - Azide and BSA Free [NBP2-93011]

Immunocytochemistry/Immunofluorescence: XK X-linked Kx blood group Antibody [NBP2-93011] - Analysis of U-2 OS cells using XK X-linked Kx blood group at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: XK X-linked Kx blood group Antibody - Azide and BSA Free [NBP2-93011]

Immunocytochemistry/ Immunofluorescence: XK X-linked Kx blood group Antibody - Azide and BSA Free [NBP2-93011]

Immunocytochemistry/Immunofluorescence: XK X-linked Kx blood group Antibody [NBP2-93011] - Analysis of C6 cells using XK X-linked Kx blood group at dilution of 1:100. Blue: DAPI for nuclear staining.
View 1 more images

Applications for XK X-linked Kx blood group Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50-1:200

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: XK X-linked Kx blood group

This locus controls the synthesis of the Kell blood group 'precursor substance' (Kx). Mutations in this gene have been associated with McLeod syndrome, an X-linked, recessive disorder characterized by abnormalities in the neuromuscular and hematopoietic systems. The encoded protein has structural characteristics of prokaryotic and eukaryotic membrane transport proteins. (provided by RefSeq)

Alternate Names

Kell blood group precursor (McLeod phenotype), Kell complex 37 kDa component, Kx, Kx antigen, membrane transport protein XK, X1k, XK, Kell blood group complex subunit (McLeod syndrome), XKR1XK-related protein 1, X-linked Kx blood group (McLeod syndrome), XRG1

Gene Symbol

XK

Additional XK X-linked Kx blood group Products

Product Documents for XK X-linked Kx blood group Antibody - Azide and BSA Free

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for XK X-linked Kx blood group Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.