ZFP36L1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-86906

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-86906
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all ZFP36L1 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZFP36L1. Peptide sequence: HMFDSPPSPQDSLSDQEGYLSSSSSSHSGSDSPTLDNSRRLPIFSRLSIS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ZFP36L1 Antibody

Western Blot: ZFP36L1 Antibody [NBP2-86906]

Western Blot: ZFP36L1 Antibody [NBP2-86906]

Western Blot: ZFP36L1 Antibody [NBP2-86906] - WB Suggested Anti-ZFP36L1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human Lung
Immunohistochemistry-Paraffin: ZFP36L1 Antibody [NBP2-86906]

Immunohistochemistry-Paraffin: ZFP36L1 Antibody [NBP2-86906]

Immunohistochemistry-Paraffin: ZFP36L1 Antibody [NBP2-86906] - Rabbit Anti-ZFP36L1 Antibody. Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue. Observed Staining: Cytoplasm in smooth muscle cells in portal vein.
Western Blot: ZFP36L1 Antibody [NBP2-86906]

Western Blot: ZFP36L1 Antibody [NBP2-86906]

Western Blot: ZFP36L1 Antibody [NBP2-86906] - WB Suggested Anti-ZFP36L1 antibody Titration: 1 ug/mL. Sample Type: Human liver
View 2 more images

Applications for ZFP36L1 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ZFP36L1

ZFP36L1 is a member of the TIS11 family of early response genes. Family members are induced by various agonists such as the phorbol ester TPA and the polypeptide mitogen EGF. The gene is well conserved across species and has a promoter that contains motifs seen in other early-response genes. The encoded protein contains a distinguishing putative zinc finger domain with a repeating cys-his motif. This putative nuclear transcription factor most likely functions in regulating the response to growth factors.

Alternate Names

ZBRK1KRAB zinc finger protein ZFQR, ZFQR, Zinc finger and BRCA1-interacting protein with a KRAB domain 1, zinc finger protein 350, Zinc finger protein ZBRK1, zinc-finger protein ZBRK1

Gene Symbol

ZFP36L1

Additional ZFP36L1 Products

Product Documents for ZFP36L1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ZFP36L1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.