ZP2 Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-93167

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-93167-0.02ml
NBP2-93167-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all ZP2 Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 651-745 of human ZP2 (NP_003451.1). KMTVSLPGPILLLSDDSSFRGVGSSDLKASGSSGEKSRSETGEEVGSRGAMDTKGHKTAGDVGSKAVAAVAAFAGVVATLGFIYYLYEKRTVSNH

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ZP2 Antibody - BSA Free

Western Blot: ZP2 AntibodyBSA Free [NBP2-93167]

Western Blot: ZP2 AntibodyBSA Free [NBP2-93167]

Western Blot: ZP2 Antibody [NBP2-93167] - Analysis of extracts of various cell lines, using ZP2 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 10s.
Immunocytochemistry/ Immunofluorescence: ZP2 Antibody - BSA Free [NBP2-93167]

Immunocytochemistry/ Immunofluorescence: ZP2 Antibody - BSA Free [NBP2-93167]

Immunocytochemistry/Immunofluorescence: ZP2 Antibody [NBP2-93167] - Immunofluorescence analysis of mouse oophoroma cells using ZP2 antibody (NBP2-93167) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: ZP2 Antibody - BSA Free [NBP2-93167]

Immunocytochemistry/ Immunofluorescence: ZP2 Antibody - BSA Free [NBP2-93167]

Immunocytochemistry/Immunofluorescence: ZP2 Antibody [NBP2-93167] - Analysis of rat oophoroma cells using ZP2 at dilution of 1:100. Blue: DAPI for nuclear staining.

Applications for ZP2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:1000-1:4000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ZP2

The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development. The protein encoded by this gene is a structural component of the zona pellucida and functions in secondary binding and penetration of acrosome-reacted spermatozoa. The nascent protein contains a N-terminal signal peptide sequence, a conserved ZP domain, a consensus furin cleavage site, and a C-terminal transmembrane domain. It is hypothesized that furin cleavage results in release of the mature protein from the plasma membrane for subsequent incorporation into the zona pellucida matrix. However, the requirement for furin cleavage in this process remains controversial based on mouse studies. [provided by RefSeq]

Long Name

Zona Pellucida Glycoprotein 2 (Sperm Receptor)

Alternate Names

Zona Pellucida Protein A, Zp-2, ZPA

Gene Symbol

ZP2

Additional ZP2 Products

Product Documents for ZP2 Antibody - BSA Free

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for ZP2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.