Skip to main content

ABCG8 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-83388PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-83388PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ABCG8.

Source: E. coli

Amino Acid Sequence: HMVQYFTAIGYPCPRYSNPADFYVDLTSIDRRSREQELATREKAQSLAALFLEKVRDLDDFLWKAETKDLDEDTCVESSVTPLDTNCLPSPTKMPGAVQQFTTLIRRQISNDFRDLP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83388.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-83388PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: ABCG8

ATP-binding cassette sub-family G member 8 (ABCG8) is a member of the superfamily of ATP-binding cassette transporters and a member of the White subfamily.

Transporter genes are involved in the regulation of the amount of dietary cholesterol retained in the body. Specifically, ABCG8 is responsible for the selective transport of dietary cholesterol in/out of the enterocytes and in the selective liver sterol excretion into bile. ABCG8 also cooperates with ABCG5 to limit intestinal absorption and promote biliary excretion of sterols.

ABCG8 is highly expressed in the liver and intestine. Mutated forms of ABCG8 lead to sterol accumulation and can cause atherosclerosis or sitosterolemia, a rare autosomal recessive disorder characterized by hyperabsorption of sterols and the inability to excrete sterols into bile.

ABCG8 antibodies are useful tools for cholesterol absorbtion/sectretion studies and are fundamental to the understanding of certian liver functions.

Alternate Names

ATP-binding cassette sub-family G member 8, ATP-binding cassette, sub-family G (WHITE), member 8, ATP-binding cassette, sub-family G (WHITE), member 8 (sterolin 2), GBD4ATP-binding cassette, subfamily G, member 8, MGC142217, sterolin 2, sterolin-2, STSL

Gene Symbol

ABCG8

Additional ABCG8 Products

Product Documents for ABCG8 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ABCG8 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...