ADAM22 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-58310PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-58310PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all ADAM22 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ADAM22.

Source: E. coli

Amino Acid Sequence: LSPAKSPSSSTGSIASSRKYPYPMPPLPDEDKKVNRQSARLWETSI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58310.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-58310PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: ADAM22

ADAM22 was first described as MDC2 (Metalloproteinase-like disintergin like cysteine rich 2) from analysis of human brain libraries, in search of brain-specific proteins. Two splice variants with different carboxyterminal ends have been described. ADAM22 participates in cell adhesion and spreading by associating with 14-3-3 proteins. It is constitutively produced in normal brain tissue, but decreased or absent in high grade gliomas. Different splice variants of ADAM22 are differentially expressed in areas of the brain. A complex of ADAM22 and LGI1 were shown to regulate synaptic transmission. Complexes of ADAM22, stargazing, and a range of other proteins anchor ADAM22 into the cytoskeleton, and keep ADAM22 in association with the postsynaptic space. ADAM22 does not contain the canonical HExxHxxxxxH zinc metalloproteinase motif, and is not thought to be proteolytically active. ADAM22 is a member of the ADAMS that function in tandem with other ADAMs and which may also have specific individual functions.

Long Name

A Disintegrin and Metalloproteinase Domain 22

Alternate Names

MDC2

Gene Symbol

ADAM22

Additional ADAM22 Products

Product Documents for ADAM22 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ADAM22 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.