Recombinant Human ADAM33 GST (N-Term) Protein

Name: Recombinant Human ADAM33 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00080332-P01

Novus Biologicals, part of Bio-Techne | Catalog # H00080332-P01

Submit a review

Product Datasheet / COA / SDS

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, Western Blot

View all ADAM33 Proteins and Enzymes »

Product Specifications

Description

Recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-85 of Human ADAM33

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MGWRPRRARGTPLLLLLLLLLLWPVPGAGVLQGHIPGQPVTPHWVLDGQPWRTVSLEEPVSKPDMGLVALEAEGQELLLELEKNQ

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

35.8 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human ADAM33 GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00080332-P01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: ADAM33

This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This protein is a type I transmembrane protein implicated in asthma and bronchial hyperresponsiveness. Alternative splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeq]

Long Name

A Disintegrin and Metalloproteinase Domain 33

Alternate Names

a disintegrin and metalloprotease 33, a disintegrin and metalloproteinase domain 33, ADAM 33, ADAM metallopeptidase domain 33, C20orf153, chromosome 20 open reading frame 153, disintegrin and metalloproteinase domain-containing protein 33, disintegrin and reprolysin metalloproteinase family protein, dJ964F7.1, DKFZp434K0521, EC 3.4.24.-, FLJ35308, FLJ36751, MGC149823, MGC71889

Gene Symbol

ADAM33

Additional ADAM33 Products

Product Documents for Recombinant Human ADAM33 GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human ADAM33 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews