ADAMTS4 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-57839PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-57839PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all ADAMTS4 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ADAMTS4.

Source: E. coli

Amino Acid Sequence: ATHILVRQQGNPGHRSIYLALKLPDGSYALNGEYTLMPSPTDVVLPGAVSLRYSGATAASETLSGHGPLAQPLTLQVLVAGNPQDTRLRYSFFVP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57839.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-57839PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: ADAMTS4

ADAMTS4, also known as aggrecanase-1, is a Metallopeptidase M12B type protease that is responsible for degradation of the articular cartilage protein aggrecan and the brain extracellular matrix proteoglycan brevican. The ADAMTS4 protein contains a signal sequence, a propeptide domain, a catalytic domain, a disintegrin-like motif, and a C-terminal domain with a thrombospondin (TSP) type 1 motif. ADAMTS4 has been implicated in inflammatory joint diseases, and it also may be a factor in the progression of glioma and Alzheimer's disease. ADAMTS4 expression has been documented in normal human brain, cartilage, heart, lung, placenta, muscle, and synovium. ESTs have been isolated from human tissue libraries, including normal brain, lung, pancreas, and skeletal muscle and cancerous breast.

Long Name

A Disintegrin-like and Metalloproteinase Domain with Thrombospondin Motifs 4

Alternate Names

ADMP-1, Aggrecanase 1

Gene Symbol

ADAMTS4

Additional ADAMTS4 Products

Product Documents for ADAMTS4 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ADAMTS4 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.